Cusabio Human Recombinants
Recombinant Human Lymphocyte antigen 6 complex locus protein G6d (LY6G6D), partial | CSB-EP013246HU1
- SKU:
- CSB-EP013246HU1
- Availability:
- 3 - 7 Working Days
Description
Recombinant Human Lymphocyte antigen 6 complex locus protein G6d (LY6G6D), partial | CSB-EP013246HU1 | Cusabio
Alternative Name(s): Megakaryocyte-enhanced gene transcript 1 protein
Gene Names: LY6G6D
Research Areas: Signal Transduction
Organism: Homo sapiens (Human)
AA Sequence: LSSLLGAALGNRMRCYNCGGSPSSSCKEAVTTCGEGRPQPGLEQIKLPGNPPVTLIHQHPACVAAHHCNQVETESVGDVTYPAHRDCYLGDLCNS
Source: E.coli
Tag Info: N-terminal 10xHis-B2M-JD-tagged
Expression Region: 10-104aa
Sequence Info: Partial
MW: 15.5 kDa
Purity: Greater than 85% as determined by SDS-PAGE.
Relevance:
Reference: "Genes encoding three new members of the leukocyte antigen 6 superfamily and a novel member of Ig superfamily, together with genes encoding the regulatory nuclear chloride ion channel protein (hRNCC) and an N omega-N omega-dimethylarginine dimethylaminohydrolase homologue, are found in a 30-kb segment of the MHC class III region." Ribas G., Neville M., Wixon J.L., Cheng J., Campbell R.D. J. Immunol. 163:278-287(1999)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function:
Involvement in disease:
Subcellular Location: Cell membrane, Lipid-anchor, GPI-anchor, Cell projection, filopodium
Protein Families:
Tissue Specificity: Expressed in the adult lung, and in fetal liver, lung, kidney, brain and spleen.
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: O95868
HGNC Database Link: HGNC
UniGene Database Link: UniGene
KEGG Database Link: KEGG
STRING Database Link: STRING
OMIM Database Link: OMIM