Recombinant Human Lymphocyte antigen 6 complex locus protein G6d (LY6G6D) | CSB-EP013246HU

(No reviews yet) Write a Review
SKU:
CSB-EP013246HU
Availability:
3 - 7 Working Days
  • Recombinant Human Lymphocyte antigen 6 complex locus protein G6d (LY6G6D)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
£196.00 - £1,021.60

Description

Recombinant Human Lymphocyte antigen 6 complex locus protein G6d (LY6G6D) | CSB-EP013246HU | Cusabio

Alternative Name(s): Megakaryocyte-enhanced gene transcript 1 protein C6orf23, G6D, MEGT1, NG25

Gene Names: LY6G6D

Research Areas: Others

Organism: Homo sapiens (Human)

AA Sequence: NRMRCYNCGGSPSSSCKEAVTTCGEGRPQPGLEQIKLPGNPPVTLIHQHPACVAAHHCNQVETESVGDVTYPAHRDCYLGDLCNS

Source: E.coli

Tag Info: N-terminal 10xHis-B2M-tagged

Expression Region: 20-104aa

Sequence Info: Full Length of Mature Protein

MW: 25.5 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance:

Reference: "Transcriptional analysis of a novel cluster of LY-6 family members in the human and mouse major histocompatibility complex: five genes with many splice forms." Mallya M., Campbell R.D., Aguado B. Genomics 80:113-123(2002)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location: Cell membrane, Lipid-anchor, GPI-anchor, Cell projection, filopodium

Protein Families:

Tissue Specificity: Expressed in the adult lung, and in fetal liver, lung, kidney, brain and spleen.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: O95868

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose