Recombinant Human Luc7-like protein 3 (LUC7L3), partial | CSB-EP530965HU

(No reviews yet) Write a Review
SKU:
CSB-EP530965HU
Availability:
13 - 23 Working Days
  • Recombinant Human Luc7-like protein 3 (LUC7L3), partial
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
£196.00 - £1,021.60

Description

Recombinant Human Luc7-like protein 3 (LUC7L3), partial | CSB-EP530965HU | Cusabio

Alternative Name(s): Cisplatin resistance-associated-overexpressed protein;Luc7AOkadaic acid-inducible phosphoprotein OA48-18cAMP regulatory element-associated protein 1 ;CRE-associated protein 1 ;CREAP-1

Gene Names: LUC7L3

Research Areas: Epigenetics and Nuclear Signaling

Organism: Homo sapiens (Human)

AA Sequence: MISAAQLLDELMGRDRNLAPDEKRSNVRWDHESVCKYYLCGFCPAELFTNTRSDLGPCEKIHDENLRKQYEKSSRFMKV

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 1-79aa

Sequence Info: Partial

MW: 13.3 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Binds cAMP regulatory elent DNA sequence. May play a role in RNA splicing.

Reference: Identification of a family of DNA-binding proteins with homology to RNA splicing factors.Shipman K.L., Robinson P.J., King B.R., Smith R., Nicholson R.C.Biochem. Cell Biol. 84:9-19(2006)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Binds cAMP regulatory element DNA sequence. May play a role in RNA splicing.

Involvement in disease:

Subcellular Location: Nucleus speckle

Protein Families: Luc7 family

Tissue Specificity: Widely expressed. Highest levels in heart, brain, pancreas, thymus, ovary, small intestine and peripheral blood leukocytes, as well as cerebellum, putamen and pituitary gland. Lowest levels in lung, liver and kidney. Also expressed in fetal tissues, including brain, heart, kidney, thymus and lung.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: O95232

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose