Recombinant Human Low affinity immunoglobulin gamma Fc region receptor II-b (FCGR2B), partial | CSB-MP008541HU1

(No reviews yet) Write a Review
SKU:
CSB-MP008541HU1
Availability:
18 - 28 Working Days
£340.00 - £3,137.60

Description

Recombinant Human Low affinity immunoglobulin gamma Fc region receptor II-b (FCGR2B), partial | CSB-MP008541HU1 | Cusabio

Alternative Name(s): CDw32 (Fc-gamma RII-b) (Fc-gamma-RIIb) (FcRII-b)

Gene Names: FCGR2B

Research Areas: Immunology

Organism: Homo sapiens (Human)

AA Sequence: APPKAVLKLEPQWINVLQEDSVTLTCRGTHSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIVLRCHSWKDKPLVKVTFFQNGKSKKFSRSDPNFSIPQANHSHSGDYHCTGNIGYTLYSSKPVTITVQAP

Source: Mammalian cell

Tag Info: C-terminal 6xHis-tagged

Expression Region: 46-217aa

Sequence Info: Partial

MW: 21.6 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance:

Reference:

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P31994

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose