Recombinant Human Low affinity immunoglobulin epsilon Fc receptor (FCER2), partial | CSB-MP008534HU

(No reviews yet) Write a Review
SKU:
CSB-MP008534HU
Availability:
18 - 28 Working Days
£285.60 - £2,503.20

Description

Recombinant Human Low affinity immunoglobulin epsilon Fc receptor (FCER2), partial | CSB-MP008534HU | Cusabio

Alternative Name(s): BLAST-2 (C-type lectin domain family 4 member J) (Fc-epsilon-RII) (Immunoglobulin E-binding factor) (Lymphocyte IgE receptor)

Gene Names: FCER2

Research Areas: Immunology

Organism: Homo sapiens (Human)

AA Sequence: DTTQSLKQLEERAARNVSQVSKNLESHHGDQMAQKSQSTQISQELEELRAEQQRLKSQDLELSWNLNGLQADLSSFKSQELNERNEASDLLERLREEVTKLRMELQVSSGFVCNTCPEKWINFQRKCYYFGKGTKQWVHARYACDDMEGQLVSIHSPEEQDFLTKHASHTGSWIGLRNLDLKGEFIWVDGSHVDYSNWAPGEPTSRSQGEDCVMMRGSGRWNDAFCDRKLGAWVCDRLATCTPPASEGSAESMGPDSRPDPDGRLPTPSAPLHS

Source: Mammalian cell

Tag Info: N-terminal 6xHis-tagged

Expression Region: 48-321aa

Sequence Info: Partial

MW: 33.2

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Low-affinity receptor for immunoglobulin E and CR2/CD21. Has essential roles in the regulation of IgE production and in the differentiation of B-cells .

Reference: "Human lymphocyte Fc receptor for IgE: sequence homology of its cloned cDNA with animal lectins." Ikuta K., Takami M., Kim C.W., Honjo T., Miyoshi T., Tagaya Y., Kawabe T., Yodoi J. Proc. Natl. Acad. Sci. U.S.A. 84:819-823(1987)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P06734

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose