Recombinant Human Low affinity immunoglobulin epsilon Fc receptor (FCER2), partial | CSB-EP008534HU

Recombinant Human Low affinity immunoglobulin epsilon Fc receptor (FCER2), partial | CSB-EP008534HU | Cusabio

Alternative Name(s): BLAST-2;C-type lectin domain family 4 member JFc-epsilon-RIIImmunoglobulin E-binding factorLymphocyte IgE receptor; CD23

Gene Names: FCER2

Research Areas: Immunology

Organism: Homo sapiens (Human)

AA Sequence: DTTQSLKQLEERAARNVSQVSKNLESHHGDQMAQKSQSTQISQELEELRAEQQRLKSQDLELSWNLNGLQADLSSFKSQELNERNEASDLLERLREEVTKLRMELQVSSGFVCNTCPEKWINFQRKCYYFGKGTKQWVHARYACDDMEGQLVSIHSPEEQDFLTKHASHTGSWIGLRNLDLKGEFIWVDGSHVDYSNWAPGEPTSRSQGEDCVMMRGSGRWNDAFCDRKLGAWVCDRLATCTPPASEGSAESMGPDSRPDPDGRLPTPSAPLHS

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 48-321aa

Sequence Info: Extracellular Domain

MW: 47 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Low-affinity receptor for immunoglobulin E (IgE) and CR2/CD21. Has essential roles in the regulation of IgE production and in the differentiation of B-cells (it is a B-cell-specific antigen).

Reference: Mutations in the autoregulatory domain of beta-tubulin 4a cause hereditary dystonia.Hersheson J., Mencacci N.E., Davis M., Macdonald N., Trabzuni D., Ryten M., Pittman A., Paudel R., Kara E., Fawcett K., Plagnol V., Bhatia K.P., Medlar A.J., Stanescu H.C., Hardy J., Kleta R., Wood N.W., Houlden H.Ann. Neurol. 73:546-553(2013)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Low-affinity receptor for immunoglobulin E (IgE) and CR2/CD21. Has essential roles in the regulation of IgE production and in the differentiation of B-cells (it is a B-cell-specific antigen).

Involvement in disease:

Subcellular Location: Cell membrane, Single-pass type II membrane protein, Cell membrane, Lipid-anchor, Secreted

Protein Families:

Tissue Specificity:

Paythway: Hematopoieticcelllineage

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P06734

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM