Recombinant Human Leukocyte-specific transcript 1 protein (LST1) | CSB-EP013217HU

Recombinant Human Leukocyte-specific transcript 1 protein (LST1) | CSB-EP013217HU | Cusabio

Alternative Name(s): Protein B144

Gene Names: LST1

Research Areas: Cancer

Organism: Homo sapiens (Human)

AA Sequence: MLSRNDVKRLERSWAQGSSEQELHYASLQRLPVPSSEGPDLRGRDKRGTKEDPRADYACIAENKPT

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 1-66aa

Sequence Info: Full Length of Isoform 10

MW: 11.5 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Possible role in modulating immune responses. Induces morphological changes including production of filopodia and microspikes when overexpressed in a variety of cell types and may be involved in dendritic cell maturation. Isoform 1 and isoform 2 have an inhibitory effect on lymphocyte proliferation.

Reference: "Complex expression pattern of the TNF region gene LST1 through differential regulation, initiation, and alternative splicing." de Baey A., Fellerhoff B., Maier S., Martinozzi S., Weidle U., Weiss E.H. Genomics 45:591-600(1997)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Possible role in modulating immune responses. Induces morphological changes including production of filopodia and microspikes when overexpressed in a variety of cell types and may be involved in dendritic cell maturation. Isoform 1 and isoform 2 have an inhibitory effect on lymphocyte proliferation.

Involvement in disease:

Subcellular Location: Membrane, Single-pass membrane protein, Golgi apparatus membrane, Single-pass membrane protein, Endomembrane system, Single-pass membrane protein

Protein Families: LST1 family

Tissue Specificity: Expressed in lung, tonsil, thymus, placenta, kidney, fetal spleen, fetal liver and brain.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: O00453

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: N/A

OMIM Database Link: OMIM