Recombinant Human Leukocyte immunoglobulin-like receptor subfamily A member 5 (LILRA5), partial | CSB-MP012937HU

Recombinant Human Leukocyte immunoglobulin-like receptor subfamily A member 5 (LILRA5), partial | CSB-MP012937HU | Cusabio

Alternative Name(s): CD85 antigen-like family member F Immunoglobulin-like transcript 11 Short name: ILT-11 Leukocyte immunoglobulin-like receptor 9 Short name: LIR-9 CD_antigen: CD85f

Gene Names: LILRA5

Research Areas: Immunology

Organism: Homo sapiens (Human)

AA Sequence: GNLSKATLWAEPGSVISRGNSVTIRCQGTLEAQEYRLVKEGSPEPWDTQNPLEPKNKARFSIPSMTEHHAGRYRCYYYSPAGWSEPSDPLELVVTGFYNKPTLSALPSPVVTSGENVTLQCGSRLRFDRFILTEEGDHKLSWTLDSQLTPSGQFQALFPVGPVTPSHRWMLRCYGSRRHILQVWSEPSDLLEIPVSGAADNLSPSQNKSDSGTASHLQDYAVENLIR

Source: Mammalian cell

Tag Info: N-terminal 6xHis-tagged

Expression Region: 42-268aa

Sequence Info: Partial

MW: 29.2 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: May play a role in triggering innate immune responses. Does not seem to play a role for any class I MHC antigen recognition.

Reference: "Crystal structure of the human monocyte-activating receptor, 'Group 2' leukocyte Ig-like receptor A5 (LILRA5/LIR9/ILT11)."Shiroishi M., Kajikawa M., Kuroki K., Ose T., Kohda D., Maenaka K.J. Biol. Chem. 281:19536-19544(2006)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: May play a role in triggering innate immune responses. Does not seem to play a role for any class I MHC antigen recognition.

Involvement in disease:

Subcellular Location: Cell membrane, Single-pass type I membrane protein, SUBCELLULAR LOCATION: Isoform 3: Secreted

Protein Families:

Tissue Specificity: Expressed mostly in tissues of the hematopoietic system, including bone marrow, spleen, lymph node and peripheral leukocytes. Among leukocytes, monocytes and neutrophils express the highest level. Expressed in CD14+ monocytes, but not in T-cells, B-cells or natural killer (NK) cells (at protein level).

Paythway: Osteoclastdifferentiation

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: A6NI73

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM