Recombinant Human Kita-kyushu lung cancer antigen 1 (CT83) | CSB-MP711093HU

(No reviews yet) Write a Review
SKU:
CSB-MP711093HU
Availability:
18 - 28 Working Days
  • Recombinant Human Kita-kyushu lung cancer antigen 1 (CT83)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€386.00 - €900.00

Description

Recombinant Human Kita-kyushu lung cancer antigen 1 (CT83) | CSB-MP711093HU | Cusabio

Alternative Name(s): Cancer/testis antigen 83

Gene Names: KKLC1

Research Areas: Cancer

Organism: Homo sapiens (Human)

AA Sequence: MNFYLLLASSILCALIVFWKYRRFQRNTGEMSSNSTALALVRPSSSGLINSNTDNNLAVYDLSRDILNNFPHSIARQKRILVNLSMVENKLVELEHTLLSKGFRGASPHRKST

Source: Mammalian cell

Tag Info: N-terminal 6xHis-tagged

Expression Region: 1-113aa

Sequence Info: Full Length

MW: 16.8 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance:

Reference: "Identification of a new cancer/germline gene, KK-LC-1, encoding an antigen recognized by autologous CTL induced on human lung adenocarcinoma."Fukuyama T., Hanagiri T., Takenoyama M., Ichiki Y., Mizukami M., So T., Sugaya M., So T., Sugio K., Yasumoto K. Cancer Res. 66:4922-4928(2006)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location: Cell membrane, Single-pass type II membrane protein

Protein Families:

Tissue Specificity: Specifically expressed in testis. Expressed by cancer cell lines.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q5H943

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose