Recombinant Human Kita-kyushu lung cancer antigen 1 (CT83) | CSB-EP711093HU

(No reviews yet) Write a Review
SKU:
CSB-EP711093HU
Availability:
3 - 7 Working Days
  • Recombinant Human Kita-kyushu lung cancer antigen 1 (CT83)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
£212.80 - £1,152.00

Description

Recombinant Human Kita-kyushu lung cancer antigen 1 (CT83) | CSB-EP711093HU | Cusabio

Alternative Name(s): Cancer/testis antigen 83

Gene Names: CT83

Research Areas: Others

Organism: Homo sapiens (Human)

AA Sequence: MNFYLLLASSILCALIVFWKYRRFQRNTGEMSSNSTALALVRPSSSGLINSNTDNNLAVYDLSRDILNNFPHSIARQKRILVNLSMVENKLVELEHTLLSKGFRGASPHRKST

Source: E.coli

Tag Info: N-terminal 6xHis-B2M-tagged

Expression Region: 1-113aa

Sequence Info: Full Length

MW: 26.8 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance:

Reference: "CXorf61 is a target for T cell based immunotherapy of triple-negative breast cancer." Paret C., Simon P., Vormbrock K., Bender C., Kolsch A., Breitkreuz A., Yildiz O., Omokoko T., Hubich-Rau S., Hartmann C., Hacker S., Wagner M., Roldan D.B., Selmi A., Tureci O., Sahin U. Oncotarget 6:25356-25367(2015)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location: Cell membrane, Single-pass type II membrane protein

Protein Families:

Tissue Specificity: Specifically expressed in testis. Expressed by cancer cell lines.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q5H943

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose