Cusabio Human Recombinants
Recombinant Human Kita-kyushu lung cancer antigen 1 (CT83) | CSB-EP711093HU
- SKU:
- CSB-EP711093HU
- Availability:
- 3 - 7 Working Days
Description
Recombinant Human Kita-kyushu lung cancer antigen 1 (CT83) | CSB-EP711093HU | Cusabio
Alternative Name(s): Cancer/testis antigen 83
Gene Names: CT83
Research Areas: Others
Organism: Homo sapiens (Human)
AA Sequence: MNFYLLLASSILCALIVFWKYRRFQRNTGEMSSNSTALALVRPSSSGLINSNTDNNLAVYDLSRDILNNFPHSIARQKRILVNLSMVENKLVELEHTLLSKGFRGASPHRKST
Source: E.coli
Tag Info: N-terminal 6xHis-B2M-tagged
Expression Region: 1-113aa
Sequence Info: Full Length
MW: 26.8 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance:
Reference: "CXorf61 is a target for T cell based immunotherapy of triple-negative breast cancer." Paret C., Simon P., Vormbrock K., Bender C., Kolsch A., Breitkreuz A., Yildiz O., Omokoko T., Hubich-Rau S., Hartmann C., Hacker S., Wagner M., Roldan D.B., Selmi A., Tureci O., Sahin U. Oncotarget 6:25356-25367(2015)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function:
Involvement in disease:
Subcellular Location: Cell membrane, Single-pass type II membrane protein
Protein Families:
Tissue Specificity: Specifically expressed in testis. Expressed by cancer cell lines.
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: Q5H943
HGNC Database Link: HGNC
UniGene Database Link: UniGene
KEGG Database Link: KEGG
STRING Database Link: STRING
OMIM Database Link: OMIM