Recombinant Human Kit ligand (KITLG), partial (Active) | CSB-AP003741HU

Recombinant Human Kit ligand (KITLG) ,partial (Active) | CSB-AP003741HU | Cusabio

Protein Description: Partial

Alternative Name (s) : Kit Ligand; Mast Cell Growth Factor; MGF; Stem Cell Factor; SCF; c-Kit ligand; KITLG; MGF; SCF

Gene Names: KITLG

Research Areas: Immunology

Species: Homo sapiens (Human)

Source: E.coli

Tag Info: Tag-Free

Expression Region: 26-189aa

Sequence Info: EGICRNRVTNNVKDVTKLVANLPKDYMITLKYVPGMDVLPSHCWISEMVVQLSDSLTDLLDKFSNISEGLSNYSIIDKLVNIVDDLVECVKENSSKDLKKSFKSPEPRLFTPEEFFRIFNRSIDAFKDFVVASETSDCVVSSTLSPEKDSRVSVTKPFMLPPVA

Biological Activity: The ED50 as determined in a cell proliferation assay using TF‑1 human erythroleukemic cells is less than 20 ng/ml.

MW: 18.4 kDa

Purity: Greater than 95% as determined by SDS-PAGE.

Endotoxin: Less than 1.0 EU/µg as determined by LAL method.

Relevance: Stem Cell Factor (SCF) is a hematopoietic growth factor that exerts its activity at the early stages of hematopoiesis. SCF stimulates the proliferation of myeloid, erythroid, and lymphoid progenitors in bone marrow cultures and has been shown to act synergistically with colony stimulating factors.

PubMed ID:

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Function: Ligand for the receptor-type protein-tyrosine kinase KIT. Plays an essential role in the regulation of cell survival and proliferation, hematopoiesis, stem cell maintenance, gametogenesis, mast cell development, migration and function, and in melanogenesis. KITLG/SCF binding can activate several signaling pathways. Promotes phosphorylation of PIK3R1, the regulatory subunit of phosphatidylinositol 3-kinase, and subsequent activation of the kinase AKT1. KITLG/SCF and KIT also transmit signals via GRB2 and activation of RAS, RAF1 and the MAP kinases MAPK1/ERK2 and/or MAPK3/ERK1. KITLG/SCF and KIT promote activation of STAT family members STAT1, STAT3 and STAT5. KITLG/SCF and KIT promote activation of PLCG1, leading to the production of the cellular signaling molecules diacylglycerol and inositol 1,4,5-trisphosphate. KITLG/SCF acts synergistically with other cytokines, probably interleukins.

Involvement in disease: Hyperpigmentation with or without hypopigmentation, familial progressive (FPHH) ; Deafness, congenital, unilateral or asymmetric (DCUA)

Subcellular Location: Isoform 1: Cell membrane, Single-pass type I membrane protein, SUBCELLULAR LOCATION: Isoform 2: Cytoplasm, Cytoplasm, cytoskeleton, Cell membrane, Single-pass type I membrane protein, Cell projection, lamellipodium, Cell projection, filopodium, SUBCELLULAR LOCATION: Soluble KIT ligand: Secreted

Protein Families: SCF family

Tissue Specificity:

Paythway: MAPKsignalingpathway

Form: Lyophilized powder

Buffer: Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.0

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P21583

Uniprot Entry Name:

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM