Recombinant Human Killer cell immunoglobulin-like receptor 2DS3 (KIR2DS3), partial | CSB-BP613530HU

(No reviews yet) Write a Review
SKU:
CSB-BP613530HU
Availability:
28 - 38 Working Days
  • Recombinant Human Killer cell immunoglobulin-like receptor 2DS3 (KIR2DS3), partial
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€406.00 - €1,327.00

Description

Recombinant Human Killer cell immunoglobulin-like receptor 2DS3 (KIR2DS3), partial | CSB-BP613530HU | Cusabio

Alternative Name(s): MHC class I NK cell receptor Natural killer-associated transcript 7 Short name: NKAT-7 NKAT7

Gene Names: KIR2DS3

Research Areas: Others

Organism: Homo sapiens (Human)

AA Sequence: HEGFRRKPSLLAHPGRLVKSEETVILQCWSDVMFEHFLLHREGTFNDTLRLIGEHIDGVSKANFSIGRMRQDLAGTYRCYGSVPHSPYQFSAPSDPLDIVITGLYEKPSLSAQPGPTVLAGESVTLSCSSWSSYDMYHLSTEGEAHERRFSAGPKVNGTFQADFPLGPATQGGTYRCFGSFHDSPYEWSKSSDPLLVSVTGNPSNSWPSPTEPSSKTGNPRHLH

Source: Baculovirus

Tag Info: N-terminal MBP-tagged and C-terminal 6xHis-tagged

Expression Region: 22-245aa

Sequence Info: Extracellular Domain

MW: 68.7 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Receptor on natural killer (NK) cells for HLA-C alleles. Does not inhibit the activity of NK cells.

Reference: "Assessment of killer cell immunoglobulinlike receptor expression and corresponding HLA class I phenotypes demonstrates heterogenous KIR expression independent of anticipated HLA class I ligands." Becker S., Tonn T., Fussel T., Uhrberg M., Bogdanow M., Seifried E., Seidl C. Hum. Immunol. 64:183-193(2003)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Receptor on natural killer (NK) cells for HLA-C alleles. Does not inhibit the activity of NK cells.

Involvement in disease:

Subcellular Location: Cell membrane, Single-pass type I membrane protein

Protein Families: Immunoglobulin superfamily

Tissue Specificity:

Paythway: Antigenprocessingandpresentation

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q14952

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: N/A

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose