Cusabio Human Recombinants
Recombinant Human Ketohexokinase (KHK) | CSB-EP012157HU
- SKU:
- CSB-EP012157HU
- Availability:
- 3 - 7 Working Days
Description
Recombinant Human Ketohexokinase (KHK) | CSB-EP012157HU | Cusabio
Alternative Name(s): Hepatic fructokinase
Gene Names: KHK
Research Areas: Signal Transduction
Organism: Homo sapiens (Human)
AA Sequence: MEEKQILCVGLVVLDVISLVDKYPKEDSEIRCLSQRWQRGGNASNSCTVLSLLGAPCAFMGSMAPGHVADFVLDDLRRYSVDLRYTVFQTTGSVPIATVIINEASGSRTILYYDRSLPDVSATDFEKVDLTQFKWIHIEGRNASEQVKMLQRIDAHNTRQPPEQKIRVSVEVEKPREELFQLFGYGDVVFVSKDVAKHLGFQSAEEALRGLYGRVRKGAVLVCAWAEEGADALGPDGKLLHSDAFPPPRVVDTLGAGDTFNASVIFSLSQGRSVQEALRFGCQVAGKKCGLQGFDGIV
Source: E.coli
Tag Info: N-terminal GST-tagged
Expression Region: 1-298aa
Sequence Info: Full Length of Isoform 2
MW: 59.7 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: Catalyzes the phosphorylation of the ketose sugar fructose to fructose-1-phosphate.
Reference: "An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome." Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D., Wang L., Ye M., Zou H. J. Proteomics 96:253-262(2014)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: Catalyzes the phosphorylation of the ketose sugar fructose to fructose-1-phosphate.
Involvement in disease: Fructosuria (FRUCT)
Subcellular Location:
Protein Families: Carbohydrate kinase PfkB family
Tissue Specificity: Most abundant in liver, kidney, gut, spleen and pancreas. Low levels also found in adrenal, muscle, brain and eye.
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: P50053
HGNC Database Link: HGNC
UniGene Database Link: UniGene
KEGG Database Link: KEGG
STRING Database Link: STRING
OMIM Database Link: OMIM