Cusabio Human Recombinants
Recombinant Human Interstitial collagenase (MMP1), partial | CSB-EP014656HU1
- SKU:
- CSB-EP014656HU1
- Availability:
- 3 - 7 Working Days
Description
Recombinant Human Interstitial collagenase (MMP1), partial | CSB-EP014656HU1 | Cusabio
Alternative Name(s): Fibroblast collagenase;Matrix metalloproteinase-1 ;MMP-1
Gene Names: MMP1
Research Areas: Developmental Biology
Organism: Homo sapiens (Human)
AA Sequence: VLTEGNPRWEQTHLTYRIENYTPDLPRADVDHAIEKAFQLWSNVTPLTFTKVSEGQADIMISFVRGDHRDNSPFDGPGGNLAHAFQPGPGIGGDAHFDEDERWTNNFREYNLHRVAAHELGHSLGLSHSTDIGALMYPSYTFSGDVQLAQDDIDGIQAIYGRSQNPVQPIGPQTPKACDSKLTFDAITTIRGEVMFFKDRFYMRTNPFYPEVELNFISVFWPQLPNGLEAAYEFADRDEVRFFKGNKYWAVQGQNVLHGYPKDIYSSFGFPRTVKHIDAALSEENTGKTYFFVANKYWRYDEYKRSMDPGYPKMIAHDFPGIGHKVDAVFMKDGFFYFFHGTRQYKFDPKTKRILTLQKANSWFNCRKN
Source: E.coli
Tag Info: N-terminal 6xHis-tagged
Expression Region: 101-469aa
Sequence Info: Partial
MW: 46.5 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: Cleaves collagens of types I, II, and III at one site in the helical domain. Also cleaves collagens of types VII and X. In case of HIV infection, interacts and cleaves the secreted viral Tat protein, leading to a decrease in neuronal Tat's mediated neurotoxicity.
Reference: Cloning and characterization of human tumor cell interstitial collagenase.Templeton N.S., Brown P.D., Levy A.T., Margulies I.M.K., Liotta L.A., Stetler-Stevenson W.G.Cancer Res. 50:5431-5437(1990)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: Cleaves collagens of types I, II, and III at one site in the helical domain. Also cleaves collagens of types VII and X
Involvement in disease:
Subcellular Location: Secreted, extracellular space, extracellular matrix
Protein Families: Peptidase M10A family
Tissue Specificity:
Paythway: PPARsignalingpathway
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: P03956
HGNC Database Link: HGNC
UniGene Database Link: UniGene
KEGG Database Link: KEGG
STRING Database Link: STRING
OMIM Database Link: OMIM