Recombinant Human Interleukin-8 (CXCL8), partial (Active) | CSB-AP004611HU

(No reviews yet) Write a Review
SKU:
CSB-AP004611HU
Availability:
5 to 10 Working Days
  • Recombinant Human Interleukin-8 (CXCL8) ,partial (Active)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
$271.20 - $572.40

Description

Recombinant Human Interleukin-8 (CXCL8) ,partial (Active) | CSB-AP004611HU | Cusabio

Protein Description: Partial

Alternative Name (s) : Interleukin-8; IL-8; C-X-C Motif Chemokine 8; Emoctakin; Granulocyte Chemotactic Protein 1; GCP-1; Monocyte-Derived Neutrophil Chemotactic Factor; MDNCF; Monocyte-Derived Neutrophil-Activating Peptide; MONAP; Neutrophil-Activating Protein 1; NAP-1; Protein 3-10C; T-Cell Chemotactic Factor; IL8; CXCL8

Gene Names: CXCL8

Research Areas: Immunology

Species: Homo sapiens (Human)

Source: E.coli

Tag Info: Tag-Free

Expression Region: 28-99aa

Sequence Info: SAKELRCQCIKTYSKPFHPKFIKELRVIESGPHCANTEIIVKLSDGRELCLDPKENWVQRVVEKFLKRAENS

Biological Activity: The ED50 as determined by its ability to activate chimeric receptor and induce reporter gene expression in HEK293 cell line used Splite TEV activity detection platform is less than 5 ng/mL.

MW: 8.45 kDa

Purity: Greater than 95% as determined by SDS-PAGE.

Endotoxin: Less than 1.0 EU/µg as determined by LAL method.

Relevance: Interleukin-8 (IL-8) belongs to the neutrophil-specific CXC family of chemokines. It is one of the initial cytokines released from a variety of cell types, including T cells, endothelial cells and fibroblasts, in response to an inflammatory stimulus and acts by recruiting neutrophils, T-cells and basophils to the site of inflammation. Elevated Interleukin-8 levels are associated with the onset of a variety of disease states.

PubMed ID:

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Function: IL-8 is a chemotactic factor that attracts neutrophils, basophils, and T-cells, but not monocytes. It is also involved in neutrophil activation. It is released from several cell types in response to an inflammatory stimulus. IL-8 (6-77) has a 5-10-fold higher activity on neutrophil activation, IL-8 (5-77) has increased activity on neutrophil activation and IL-8 (7-77) has a higher affinity to receptors CXCR1 and CXCR2 as compared to IL-8 (1-77) , respectively.

Involvement in disease:

Subcellular Location: Secreted

Protein Families: Intercrine alpha (chemokine CxC) family

Tissue Specificity:

Paythway: Chemokinesignalingpathway

Form: Lyophilized powder

Buffer: Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P10145

Uniprot Entry Name:

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose