Recombinant Human Interleukin-3 (IL3) | CSB-EP011652HUc7

Recombinant Human Interleukin-3 (IL3) | CSB-EP011652HUc7 | Cusabio

Alternative Name(s): Hematopoietic growth factor Mast cell growth factor

Gene Names: IL3

Research Areas: Immunology

Organism: Homo sapiens (Human)

AA Sequence: APMTQTTPLKTSWVNCSNMIDEIITHLKQPPLPLLDFNNLNGEDQDILMENNLRRPNLEAFNRAVKSLQNASAIESILKNLLPCLPLATAAPTRHPIHIKDGDWNEFRRKLTFYLKTLENAQAQQTTLSLAIF

Source: E.coli

Tag Info: C-terminal 6xHis-tagged

Expression Region: 20-152aa

Sequence Info: Full Length of Mature Protein

MW: 17.1 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Granulocyte/macrophage colony-stimulating factors are cytokines that act in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and the monocytes-macrophages. This CSF induces granulocytes, macrophages, mast cells, stem cells, erythroid cells, eosinophils and megakaryocytes.

Reference: "Association between a single-nucleotide polymorphism in the promoter of the human interleukin-3 gene and rheumatoid arthritis in Japanese patients, and maximum-likelihood estimation of combinatorial effect that two genetic loci have on susceptibility to the disease." Yamada R., Tanaka T., Unoki M., Nagai T., Sawada T., Ohnishi Y., Tsunoda T., Yukioka M., Maeda A., Suzuki K., Tateishi H., Ochi T., Nakamura Y., Yamamoto K. Am. J. Hum. Genet. 68:674-685(2001)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Granulocyte/macrophage colony-stimulating factors are cytokines that act in hematopoiesis by controlling the production, differentiation, and function of 2 related white cell populations of the blood, the granulocytes and the monocytes-macrophages.; FUNCTION

Involvement in disease:

Subcellular Location: Secreted

Protein Families: IL-3 family

Tissue Specificity: Activated T-cells, mast cells, natural killer cells.

Paythway: Jak-STATsignalingpathway

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P08700

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM