Recombinant Human Interleukin-22 (IL22), partial (Active) | CSB-AP004361HU

(No reviews yet) Write a Review
SKU:
CSB-AP004361HU
Availability:
5 to 10 Working Days
  • Recombinant Human Interleukin-22 (IL22) ,partial (Active)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
$345.60 - $782.40

Description

Recombinant Human Interleukin-22 (IL22) ,partial (Active) | CSB-AP004361HU | Cusabio

Protein Description: Partial

Alternative Name (s) : Interleukin-22;IL-22;Cytokine Zcyto18;IL-10-related T-cell-derived-inducible factor;IL-TIF; IL22;ILTIF; ZCYTO18

Gene Names: IL22

Research Areas: Immunology

Species: Homo sapiens (Human)

Source: E.coli

Tag Info: Tag-Free

Expression Region: 34-179aa

Sequence Info: APISSHCRLDKSNFQQPYITNRTFMLAKEASLADNNTDVRLIGEKLFHGVSMSERCYLMKQVLNFTLEEVLFPQSDRFQPYMQEVVPFLARLSNRLSTCHIEGDDLHIQRNVQKLKDTVKKLGESGEIKAIGELDLLFMSLRNACI

Biological Activity: The ED50 as determined by its ability to induce IL-10 secretion in COLO 205 human colorectal adenocarcinoma cells is less than 1 ng/ml.

MW: 16.9 kDa

Purity: Greater than 95% as determined by SDS-PAGE.

Endotoxin: Less than 1.0 EU/µg as determined by LAL method.

Relevance: Interleukin-22 (IL-22) is a member of a group of the IL-10 family, a class of potent mediators of cellular inflammatory responses. IL-22 is produced by activated DC and T cells. IL-22 and IL-10 receptor chains play a role in cellular targeting and signal transduction. It can initiate and regulate innate immune responses against bacterial pathogens especially in epithelial cells such as respiratory and gut epithelial cells. IL-22 along with IL-17 likely plays a role in the coordinated response of both adaptive and innate immune systems. IL-22 also promotes hepatocyte survival in the liver and epithelial cells in the lung and gut similar to IL-10. Biological activity of IL-22 is initiated by binding to a cell-surface complex consisting of IL-22R1 and IL-10R2 receptor chains. IL-22 biological activity is further regulated by interactions with a soluble binding protein, IL-22BP. IL-22BP and an extracellular region of IL-22R1 share sequence similarity. In some cases, the pro-inflammatory versus tissue-protective functions of IL-22 are regulated by cytokine IL-17A.

PubMed ID:

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Function: Cytokine that contributes to the inflammatory response in vivo.

Involvement in disease:

Subcellular Location: Secreted

Protein Families: IL-10 family

Tissue Specificity:

Paythway: Jak-STATsignalingpathway

Form: Lyophilized powder

Buffer: Lyophilized from a 0.2 μm filtered 20 mM PB, 150 mM NaCl, pH 7.4

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q9GZX6

Uniprot Entry Name:

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose