Recombinant Human Interleukin-11 (IL11), partial (Active) | CSB-AP004581HU

(No reviews yet) Write a Review
SKU:
CSB-AP004581HU
Availability:
5 to 10 Working Days
  • Recombinant Human Interleukin-11 (IL11) ,partial (Active)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
$345.60 - $782.40

Description

Recombinant Human Interleukin-11 (IL11) ,partial (Active) | CSB-AP004581HU | Cusabio

Protein Description: Partial

Alternative Name (s) : Interleukin-11; IL-11; Adipogenesis Inhibitory Factor; AGIF; Oprelvekin; IL11

Gene Names: IL11

Research Areas: Immunology

Species: Homo sapiens (Human)

Source: Yeast

Tag Info: Tag-Free

Expression Region: 23-199aa

Sequence Info: GPPPGPPRVSPDPRAELDSTVLLTRSLLADTRQLAAQLRDKFPADGDHNLDSLPTLAMSAGALGALQLPGVLTRLRADLLSYLRHVQWLRRAGGSSLKTLEPELGTLQARLDRLLRRLQLLMSRLALPQPPPDPPAPPLAPPSSAWGGIRAAHAILGGLHLTLDWAVRGLLLLKTRL

Biological Activity: The ED50 as determined in a cell proliferation assay using murine 7TD1 cells is typically 0.2 ng/mL

MW: 19 kDa

Purity: Greater than 95% as determined by SDS-PAGE.

Endotoxin: Less than 1.0 EU/µg as determined by LAL method.

Relevance: Interleukin 11 (IL-11) is a member of a family of human growth factors that includes human growth hormone, granulocyte colony-stimulating factor, and other growth factors. IL-11 is a thrombopoietic growth factor that directly stimulates the proliferation of hematopoietic stem cells and megakaryocyte progenitor cells and induces megakaryocyte maturation resulting in increased platelet production. It also promotes the proliferation of hepatocytes in response to liver damage. Binding to its receptor formed by IL6ST and either IL11RA1 or IL11RA2, It activates a signaling cascade that promotes cell proliferation. The signaling leads to the activation of intracellular protein kinases and the phosphorylation of STAT3.

PubMed ID:

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Function: Cytokine that stimulates the proliferation of hematopoietic stem cells and megakaryocyte progenitor cells and induces megakaryocyte maturation resulting in increased platelet production

Involvement in disease:

Subcellular Location: Secreted

Protein Families: IL-6 superfamily

Tissue Specificity:

Paythway: Jak-STATsignalingpathway

Form: Lyophilized powder

Buffer: Lyophilized from a 0.2 μm filtered 20 mM PB, 2% Glycine, pH 7.2

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P20809

Uniprot Entry Name:

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose