Cusabio Active Proteins
Recombinant Human Interleukin-11 (IL11), partial (Active) | CSB-AP004581HU
- SKU:
 - CSB-AP004581HU
 - Availability:
 - 5 to 10 Working Days
 
Description
Recombinant Human Interleukin-11 (IL11) ,partial (Active) | CSB-AP004581HU | Cusabio
Protein Description: Partial
Alternative Name (s) : Interleukin-11; IL-11; Adipogenesis Inhibitory Factor; AGIF; Oprelvekin; IL11
Gene Names: IL11
Research Areas: Immunology
Species: Homo sapiens (Human)
Source: Yeast
Tag Info: Tag-Free
Expression Region: 23-199aa
Sequence Info: GPPPGPPRVSPDPRAELDSTVLLTRSLLADTRQLAAQLRDKFPADGDHNLDSLPTLAMSAGALGALQLPGVLTRLRADLLSYLRHVQWLRRAGGSSLKTLEPELGTLQARLDRLLRRLQLLMSRLALPQPPPDPPAPPLAPPSSAWGGIRAAHAILGGLHLTLDWAVRGLLLLKTRL
Biological Activity: The ED50 as determined in a cell proliferation assay using murine 7TD1 cells is typically 0.2 ng/mL
MW: 19 kDa
Purity: Greater than 95% as determined by SDS-PAGE.
Endotoxin: Less than 1.0 EU/µg as determined by LAL method.
Relevance: Interleukin 11 (IL-11) is a member of a family of human growth factors that includes human growth hormone, granulocyte colony-stimulating factor, and other growth factors. IL-11 is a thrombopoietic growth factor that directly stimulates the proliferation of hematopoietic stem cells and megakaryocyte progenitor cells and induces megakaryocyte maturation resulting in increased platelet production. It also promotes the proliferation of hepatocytes in response to liver damage. Binding to its receptor formed by IL6ST and either IL11RA1 or IL11RA2, It activates a signaling cascade that promotes cell proliferation. The signaling leads to the activation of intracellular protein kinases and the phosphorylation of STAT3.
PubMed ID:
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.
Function: Cytokine that stimulates the proliferation of hematopoietic stem cells and megakaryocyte progenitor cells and induces megakaryocyte maturation resulting in increased platelet production
Involvement in disease:
Subcellular Location: Secreted
Protein Families: IL-6 superfamily
Tissue Specificity:
Paythway: Jak-STATsignalingpathway
Form: Lyophilized powder
Buffer: Lyophilized from a 0.2 μm filtered 20 mM PB, 2% Glycine, pH 7.2
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: P20809
Uniprot Entry Name:
HGNC Database Link: HGNC
UniGene Database Link: UniGene
KEGG Database Link: KEGG
STRING Database Link: STRING
OMIM Database Link: OMIM