Recombinant Human Interferon gamma (IFNG) (Active) | CSB-AP004201HU

Recombinant Human Interferon gamma (IFNG) (Active) | CSB-AP004201HU | Cusabio

Protein Description: Full Length of Mature Protein

Alternative Name (s) : Interferon Gamma; IFN-Gamma; Immune Interferon; IFNG

Gene Names: IFNG

Research Areas: Immunology

Species: Homo sapiens (Human)

Source: E.coli

Tag Info: Tag-Free

Expression Region: 24-166aa

Sequence Info: QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQ

Biological Activity: The ED50 as determined by a viral resistance assay using HT-29 cells is 17 pg/mL.

MW: 16.88 kDa

Purity: Greater than 95% as determined by SDS-PAGE.

Endotoxin: Less than 1.0 EU/µg as determined by LAL method.

Relevance: IFNγ is the major interferon produced by mitogenically or antigenically stimulated lymphocytes. It is structurally different from type I interferon and its major activity is immunoregulation. It has been implicated in the expression of class II histocompatibility antigens in cells that do not normally produce them, leading to autoimmune disease. Interferon gamma is produced mainly byT-cells and natural killer cells activated by antigens, mitogens, or alloantigens. It is produced by lymphocytes expressing the surface antigens CD4 and CD8. IFNγ synthesis is induced by IL-2, FGF-basic, and EGF.

PubMed ID:

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Function: Produced by lymphocytes activated by specific antigens or mitogens. IFN-gamma, in addition to having antiviral activity, has important immunoregulatory functions. It is a potent activator of macrophages, it has antiproliferative effects on transformed cells and it can potentiate the antiviral and antitumor effects of the type I interferons.

Involvement in disease: Aplastic anemia (AA)

Subcellular Location: Secreted

Protein Families: Type II (or gamma) interferon family

Tissue Specificity: Released primarily from activated T lymphocytes.

Paythway: HIF-1signalingpathway

Form: Lyophilized powder

Buffer: Lyophilized from a 0.2 μm filtered solution of 20mM Tris-HCl, 250mM NaCl, pH 8.5.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P01579

Uniprot Entry Name:

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM