Recombinant Human Interferon epsilon (IFNE) | CSB-EP803137HU

Recombinant Human Interferon epsilon (IFNE) | CSB-EP803137HU | Cusabio

Alternative Name(s): Interferon epsilon-1

Gene Names: IFNE

Research Areas: Immunology

Organism: Homo sapiens (Human)

AA Sequence: LDLKLIIFQQRQVNQESLKLLNKLQTLSIQQCLPHRKNFLLPQKSLSPQQYQKGHTLAILHEMLQQIFSLFRANISLDGWEENHTEKFLIQLHQQLEYLEALMGLEAEKLSGTLGSDNLRLQVKMYFRRIHDYLENQDYSTCAWAIVQVEISRCLFFVFSLTEKLSKQGRPLNDMKQELTTEFRSPR

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 22-208aa

Sequence Info: Full Length of Mature Protein

MW: 26.1 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Type I interferon required for maintaining basal levels of IFN-regulated genes, including 2'-5'-oligoadenylate synthetase, IRF7 and ISG15, in the fale reproductive tract. Directly mediates protection against viral and bacterial genital infections .

Reference: Interferon-epsilon protects the female reproductive tract from viral and bacterial infection.Fung K.Y., Mangan N.E., Cumming H., Horvat J.C., Mayall J.R., Stifter S.A., De Weerd N., Roisman L.C., Rossjohn J., Robertson S.A., Schjenken J.E., Parker B., Gargett C.E., Nguyen H.P., Carr D.J., Hansbro P.M., Hertzog P.J.Science 339:1088-1092(2013)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Type I interferon required for maintaining basal levels of IFN-regulated genes, including 2'-5'-oligoadenylate synthetase, IRF7 and ISG15, in the female reproductive tract. Directly mediates protection against viral and bacterial genital infections (By similarity).

Involvement in disease:

Subcellular Location: Secreted

Protein Families: Alpha/beta interferon family

Tissue Specificity: Endometrium-specific.

Paythway: Jak-STATsignalingpathway

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q86WN2

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM