Recombinant Human Interferon alpha-16 (IFNA16) | CSB-EP011036HU

Recombinant Human Interferon alpha-16 (IFNA16) | CSB-EP011036HU | Cusabio

Alternative Name(s): IFN-alpha-16;Interferon alpha-WA

Gene Names: IFNA16

Research Areas: Others

Organism: Homo sapiens (Human)

AA Sequence: CDLPQTHSLGNRRALILLAQMGRISHFSCLKDRYDFGFPQEVFDGNQFQKAQAISAFHEMIQQTFNLFSTKDSSAAWDETLLDKFYIELFQQLNDLEACVTQEVGVEEIALMNEDSILAVRKYFQRITLYLMGKKYSPCAWEVVRAEIMRSFSFSTNLQKGLRRKD

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 24-189aa

Sequence Info: Full Length of Mature Protein

MW: 23.4 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Produced by macrophages, IFN-alpha have antiviral activities. Interferon stimulates the production of two enzymes: a protein kinase and an oligoadenylate synthetase.

Reference: "Ligand-induced assembling of the type I interferon receptor on supported lipid bilayers." Lamken P., Lata S., Gavutis M., Piehler J. J Mol Biol 341:303-318(2004)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P05015

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A