Recombinant Human Inter-alpha-trypsin inhibitor heavy chain H5 (ITIH5), Partial | CSB-EP768213HU

(No reviews yet) Write a Review
SKU:
CSB-EP768213HU
Availability:
3 - 7 Working Days
  • Recombinant Human Inter-alpha-trypsin inhibitor heavy chain H5 (ITIH5), Partial
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
£196.00 - £1,021.60

Description

Recombinant Human Inter-alpha-trypsin inhibitor heavy chain H5 (ITIH5), Partial | CSB-EP768213HU | Cusabio

Alternative Name(s): ITIH5; KIAA1953; PP14776; UNQ311/PRO354; Inter-alpha-trypsin inhibitor heavy chain H5; ITI heavy chain H5; ITI-HC5; Inter-alpha-inhibitor heavy chain 5

Gene Names: ITIH5

Research Areas: Cancer

Organism: Homo sapiens (Human)

AA Sequence: VPRQVRLLQRLKTKPLMTEFSVKSTIISRYAFTTVSCRMLNRASEDQDIEFQMQIPAAAFITNFTMLIGDKVYQGEITEREKKSGDRVKEKRNKTTEENGEKGTEIFRASAVIPSKDKAAFFLSYEE

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 35-161aa

Sequence Info: Partial

MW: 30.6 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: May act as a tumor suppressor.

Reference: ITIH5, a novel member of the inter-alpha-trypsin inhibitor heavy chain family is downregulated in breast cancer.Himmelfarb M., Klopocki E., Grube S., Staub E., Klaman I., Hinzmann B., Kristiansen G., Rosenthal A., Duerst M., Dahl E.Cancer Lett. 204:69-77(2004)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: May act as a tumor suppressor.

Involvement in disease:

Subcellular Location: Secreted

Protein Families: ITIH family

Tissue Specificity: Abundantly expressed in placenta. Less abundant expression in mammary gland and ovary. Expression is barely detectable levels in all other tissues tested.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q86UX2

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose