Recombinant Human Inter-alpha-trypsin inhibitor heavy chain H4 (ITIH4), partial | CSB-YP617923HU

(No reviews yet) Write a Review
SKU:
CSB-YP617923HU
Availability:
3 - 7 Working Days
  • Recombinant Human Inter-alpha-trypsin inhibitor heavy chain H4 (ITIH4), partial
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
£271.20 - £1,618.40

Description

Recombinant Human Inter-alpha-trypsin inhibitor heavy chain H4 (ITIH4), partial | CSB-YP617923HU | Cusabio

Alternative Name(s): Inter-alpha-trypsin inhibitor family heavy chain-related protein

Gene Names: ITIH4

Research Areas: Others

Organism: Homo sapiens (Human)

AA Sequence: RLAILPASAPPATSNPDPAVSRVMNMKIEETTMTTQTPAPIQAPSAILPLPGQSVERLCVDPRHRQGPVNLLSDPEQGVEVTGQYEREKAGFSWIEVTFKNPLVWVHASPEHVVVTRNRRSSAYKWKETLFSVMPGLKMTMDKTGLLLLSDPDKVTIGLLFWDGRGEGLRLLLRDTDRFSSHVGGTLGQFYQEVLWGSPAASDDGRRTLRVQGNDHSATRERRLDYQEGPPGVEISCWSVEL

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

Expression Region: 689-930aa

Sequence Info: Partial

MW: 28.9 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Type II acute-phase protein (APP) involved in inflammatory responses to trauma. May also play a role in liver development or regeneration.

Reference: "BIP co-chaperone MTJ1/ERDJ1 interacts with inter-alpha-trypsin inhibitor heavy chain 4." Kroczynska B., King-Simmons L., Alloza L., Alava M.A., Elguindi E.C., Blond S.Y. Biochem. Biophys. Res. Commun. 338:1467-1477(2005)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Type II acute-phase protein (APP) involved in inflammatory responses to trauma. May also play a role in liver development or regeneration.

Involvement in disease:

Subcellular Location: Secreted

Protein Families: ITIH family

Tissue Specificity: Liver specific.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q14624

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose