Recombinant Human Inter-alpha-trypsin inhibitor heavy chain H3 (ITIH3), partial | CSB-EP2286HU

(No reviews yet) Write a Review
SKU:
CSB-EP2286HU
Availability:
3 - 7 Working Days
$357.60 - $2,042.40

Description

Recombinant Human Inter-alpha-trypsin inhibitor heavy chain H3 (ITIH3), partial | CSB-EP2286HU | Cusabio

Alternative Name(s): Inter-alpha-trypsin inhibitor heavy chain H3(ITI heavy chain H3)(ITI-HC3)(Inter-alpha-inhibitor heavy chain 3)(Serum-derived hyaluronan-associated protein)(SHAP)

Gene Names: ITIH3

Research Areas: Others

Organism: Homo sapiens (Human)

AA Sequence: MNSFKADVKGHGATNDLTFTEEVDMKEMEKALQERDYIFGNYIERLWAYLTIEQLLEKRKNAHGEEKENLTARALDLSLKYHFVTPLTSMVVTKPEDNEDERAIADKPGEDAEATPVSPAMSYLTSYQPPQNPYYYVDGD

Source: E.coli

Tag Info: N-terminal 10xHis-GST-tagged and C-terminal Myc-tagged

Expression Region: 512-651aa

Sequence Info: Partial

MW: 51.2 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: May act as a carrier of hyaluronan in serum or as a binding protein between hyaluronan and other matrix protein, including those on cell surfaces in tissues to regulate the localization, synthesis and degradation of hyaluronan which are essential to cells undergoing biological processes.

Reference: "Inhibition of tumor growth and metastatic spreading by overexpression of inter-alpha-trypsin inhibitor family chains." Paris S., Sesboue R., Delpech B., Chauzy C., Thiberville L., Martin J.P., Frebourg T., Diarra-Mehrpour M. Int J Cancer 97:615-620(2002)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q06033

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose