Cusabio Human Recombinants
Recombinant Human Inter-alpha-trypsin inhibitor heavy chain H3 (ITIH3), partial | CSB-EP2286HU
- SKU:
- CSB-EP2286HU
- Availability:
- 3 - 7 Working Days
Description
Recombinant Human Inter-alpha-trypsin inhibitor heavy chain H3 (ITIH3), partial | CSB-EP2286HU | Cusabio
Alternative Name(s): Inter-alpha-trypsin inhibitor heavy chain H3(ITI heavy chain H3)(ITI-HC3)(Inter-alpha-inhibitor heavy chain 3)(Serum-derived hyaluronan-associated protein)(SHAP)
Gene Names: ITIH3
Research Areas: Others
Organism: Homo sapiens (Human)
AA Sequence: MNSFKADVKGHGATNDLTFTEEVDMKEMEKALQERDYIFGNYIERLWAYLTIEQLLEKRKNAHGEEKENLTARALDLSLKYHFVTPLTSMVVTKPEDNEDERAIADKPGEDAEATPVSPAMSYLTSYQPPQNPYYYVDGD
Source: E.coli
Tag Info: N-terminal 10xHis-GST-tagged and C-terminal Myc-tagged
Expression Region: 512-651aa
Sequence Info: Partial
MW: 51.2 kDa
Purity: Greater than 85% as determined by SDS-PAGE.
Relevance: May act as a carrier of hyaluronan in serum or as a binding protein between hyaluronan and other matrix protein, including those on cell surfaces in tissues to regulate the localization, synthesis and degradation of hyaluronan which are essential to cells undergoing biological processes.
Reference: "Inhibition of tumor growth and metastatic spreading by overexpression of inter-alpha-trypsin inhibitor family chains." Paris S., Sesboue R., Delpech B., Chauzy C., Thiberville L., Martin J.P., Frebourg T., Diarra-Mehrpour M. Int J Cancer 97:615-620(2002)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function:
Involvement in disease:
Subcellular Location:
Protein Families:
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: Q06033
HGNC Database Link: N/A
UniGene Database Link: N/A
KEGG Database Link: N/A
STRING Database Link: N/A
OMIM Database Link: N/A