Recombinant Human Integrin-linked protein kinase (ILK), partial | CSB-RP009994h

Recombinant Human Integrin-linked protein kinase (ILK), partial | CSB-RP009994h | Cusabio

Alternative Name(s): 59KDA serine/threonine-protein kinaseILK-1ILK-2p59ILK

Gene Names: ILK

Research Areas: Signal Transduction

Organism: Homo sapiens (Human)

AA Sequence: MDDIFTQCREGNAVAVRLWLDNTENDLNQGDDHGFSPLHWACREGRSAVVEMLIMRGARINVMNRGDDTPLHLAASHGHRDIVQKLLQYKADINAVNEHGNVPLHYACFWGQDQVAEDLVANGALVSICNKYGEMPVDKAKAPLRELLRERAEKMGQNLNRIPYKDTFWKGTTRTRPRNGTLNKHSGIDFKQLNFLTKLNENHSGELWKGRWQGNDIVVKVLKVRDWS

Source: E.coli

Tag Info: N-terminal 6xHis-tagged

Expression Region: 1-228aa

Sequence Info: Partial

MW: 30 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Receptor-proximal protein kinase regulating integrin-mediated signal transduction. May act as a mediator of inside-out integrin signaling. Focal adhesion protein part of the complex ILK-PINCH. This complex is considered to be one of the convergence points of integrin- and growth factor-signaling pathway. Could be implicated in mediating cell architecture, adhesion to integrin substrates and anchorage-dependent growth in epithelial cells. Phosphorylates beta-1 and beta-3 integrin subunit on serine and threonine residues, but also AKT1 and GSK3B.

Reference: Regulation of cell adhesion and anchorage-dependent growth by a new beta 1-integrin-linked protein kinase.Hannigan G.E., Leung-Hagesteijn C., Fitz-Gibbon L., Coppolino M.G., Radeva G., Filmus J., Bell J.C., Dedhar S.Nature 379:91-96(1996)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Receptor-proximal protein kinase regulating integrin-mediated signal transduction

Involvement in disease:

Subcellular Location: Cell junction, focal adhesion, Cell membrane, Peripheral membrane protein, Cytoplasmic side, Cell projection, lamellipodium, Cytoplasm, myofibril, sarcomere

Protein Families: Protein kinase superfamily, TKL Ser/Thr protein kinase family

Tissue Specificity: Highly expressed in heart followed by skeletal muscle, pancreas and kidney. Weakly expressed in placenta, lung and liver.

Paythway: PPARsignalingpathway

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q13418

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM