Recombinant Human Insulin-like growth factor II (IGF2) (Active) | CSB-AP003891HU

Recombinant Human Insulin-like growth factor II (IGF2) (Active) | CSB-AP003891HU | Cusabio

Protein Description: Full Length of Mature Protein

Alternative Name (s) : Insulin-Like Growth Factor II; IGF-II; Somatomedin-A; IGF2; PP1446

Gene Names: IGF2

Research Areas: Signal Transduction

Species: Homo sapiens (Human)

Source: E.coli

Tag Info: Tag-Free

Expression Region: 25-91aa

Sequence Info: AYRPSETLCGGELVDTLQFVCGDRGFYFSRPASRVSRRSRGIVEECCFRSCDLALLETYCATPAKSE

Biological Activity: The ED50 as determined in a serum-free cell proliferation assay using MCF‑7 human breast cancer cells is less than 20 ng/ml.

MW: 8.91 kDa

Purity: Greater than 95% as determined by SDS-PAGE.

Endotoxin: Less than 1.0 EU/µg as determined by LAL method.

Relevance: Insulin-Like Growth Factor II (IGF2) belongs to the insulin family of polypeptide growth factors that is involved in development and growth. Members of this family are structurally homologous to proinsulin, and share higher sequence identity. IGF2 is expressed only from the paternally inherited allele and believed to be secreted by the liver and to circulate in the blood. IGF2 possess growth-promoting activity and can stimulate the proliferation and survival of various cell types including muscle, bone, and cartilage tissue in vitro. IGF2 is influenced by placental lactogen and may play a role in fetal development.

PubMed ID:

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Function: The insulin-like growth factors possess growth-promoting activity. Major fetal growth hormone in mammals. Plays a key role in regulating fetoplacental development. IGF-II is influenced by placental lactogen. Also involved in tissue differentiation. Positively regulates myogenic transcription factor MYOD1 function by facilitating the recruitment of transcriptional coactivators, thereby controlling muscle terminal differentiation (By similarity) . In adults, involved in glucose metabolism in adipose tissue, skeletal muscle and liver (Probable) .

Involvement in disease: Silver-Russell syndrome (SRS) ; Growth restriction, severe, with distinctive facies (GRDF)

Subcellular Location: Secreted

Protein Families: Insulin family

Tissue Specificity: Expressed in heart, placenta, lung, liver, muscle, kidney, tongue, limb, eye and pancreas.

Paythway: MAPKsignalingpathway

Form: Lyophilized powder

Buffer: Lyophilized from a 0.2 μm Filtered 5 mM HAC, PH 3.0

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P01344

Uniprot Entry Name:

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM