Recombinant Human Insulin-like growth factor I (IGF1), partial (Active) | CSB-AP003721HU

Recombinant Human Insulin-like growth factor I (IGF1) ,partial (Active) | CSB-AP003721HU | Cusabio

Protein Description: Partial

Alternative Name (s) : Insulin-Like Growth Factor I; IGF-I; Mechano Growth Factor; MGF; Somatomedin-C; IGF1; IBP1

Gene Names: IGF1

Research Areas: Signal Transduction

Species: Homo sapiens (Human)

Source: E.coli

Tag Info: Tag-Free

Expression Region: 52-118aa

Sequence Info: TLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSA

Biological Activity: The ED50 as determined in a serum-free cell proliferation assay using MCF‑7 human breast cancer cells is typically 1-8 ng/mL

MW: 7.3 kDa

Purity: Greater than 95% as determined by SDS-PAGE.

Endotoxin: Less than 0.5 EU/µg as determined by LAL method.

Relevance: Insulin-like growth factor I (IGF1) belongs to the family of insulin-like growth factors that are structurally homologous to proinsulin. Mature IGFs are generated by proteolytic processing of inactive precursor protein containing N-terminal and C-terminal propeptide regions. Mature human IGF-I consisting of 70 amino acids with 94% identity with mouse IGF1 and exhibits cross-species activity. IGF1 binds IGF-1R, IGF-2R, and the insulin receptor and plays a key role in cell cycle progression, cell proliferation and tumor progression. IGF1 expression is regulated by growth hormone.

PubMed ID:

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Function: The insulin-like growth factors, isolated from plasma, are structurally and functionally related to insulin but have a much higher growth-promoting activity. May be a physiological regulator of [1-14C]-2-deoxy-D-glucose (2DG) transport and glycogen synthesis in osteoblasts. Stimulates glucose transport in bone-derived osteoblastic (PyMS) cells and is effective at much lower concentrations than insulin, not only regarding glycogen and DNA synthesis but also with regard to enhancing glucose uptake. May play a role in synapse maturation

Involvement in disease: Insulin-like growth factor I deficiency (IGF1 deficiency)

Subcellular Location: Secreted

Protein Families: Insulin family

Tissue Specificity:

Paythway: HIF-1signalingpathway

Form: Lyophilized powder

Buffer: Lyophilized from a 0.2 μm Filtered 20 mM NaAc-HAC, pH 4.5

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P05019

Uniprot Entry Name:

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM