Recombinant Human Insulin-like growth factor-binding protein 3 receptor (TMEM219), partial | CSB-EP023813HU

(No reviews yet) Write a Review
SKU:
CSB-EP023813HU
Availability:
3 - 7 Working Days
  • Recombinant Human Insulin-like growth factor-binding protein 3 receptor (TMEM219), partial
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€298.00 - €1,702.00

Description

Recombinant Human Insulin-like growth factor-binding protein 3 receptor (TMEM219), partial | CSB-EP023813HU | Cusabio

Alternative Name(s): Transmembrane protein 219

Gene Names: TMEM219

Research Areas: Cardiovascular

Organism: Homo sapiens (Human)

AA Sequence: SFLLTHRTGLRSPDIPQDWVSFLRSFGQLTLCPRNGTVTGKWRGSHVVGLLTTLNFGDGPDRNKTRTFQATVLGSQMGLKGSSAGQLVLITARVTTERTAGTCLYFSAVPGILPSSQPPISCSEEGAGNATLSPRMGEECVSVWSHEGLVLTKLLTSEELALCGSR

Source: E.coli

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

Expression Region: 39-204aa

Sequence Info: Partial

MW: 22.7 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Cell death receptor specific for IGFBP3, may mediate caspase-8-dependent apoptosis upon ligand binding.

Reference: "IL-13Ralpha2 uses TMEM219 in chitinase 3-like-1-induced signalling and effector responses." Lee C.M., He C.H., Nour A.M., Zhou Y., Ma B., Park J.W., Kim K.H., Dela Cruz C., Sharma L., Nasr M.L., Modis Y., Lee C.G., Elias J.A. Nat Commun 7:12752-12752(2016)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q86XT9

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose