Recombinant Human Insulin growth factor-like family member 1 (IGFL1) | CSB-EP764932HU

Recombinant Human Insulin growth factor-like family member 1 (IGFL1) | CSB-EP764932HU | Cusabio

Alternative Name(s): IGFL1; UNQ644/PRO1274; Insulin growth factor-like family member 1

Gene Names: IGFL1

Research Areas: Others

Organism: Homo sapiens (Human)

AA Sequence: APVAPMTPYLMLCQPHKRCGDKFYDPLQHCCYDDAVVPLARTQTCGNCTFRVCFEQCCPWTFMVKLINQNCDSARTSDDRLCRSVS

Source: E.coli

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

Expression Region: 25-110aa

Sequence Info: Full Length of Mature Protein

MW: 16.8 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Probable ligand of the IGFLR1 cell membrane receptor.

Reference: "Murine IGFL and human IGFL1 are induced in inflammatory skin conditions and bind to a novel TNF receptor family member, IGFLR1." Lobito A.A., Ramani S.R., Tom I., Bazan J.F., Luis E., Fairbrother W.J., Ouyang W., Gonzalez L.C. J. Biol. Chem. 286:18969-18981(2011)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Probable ligand of the IGFLR1 cell membrane receptor.

Involvement in disease:

Subcellular Location: Secreted

Protein Families: IGFL family

Tissue Specificity: Detected in ovary and spinal cord.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q6UW32

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: N/A

OMIM Database Link: OMIM