Recombinant Human Inactive tyrosine-protein kinase transmembrane receptor ROR1 (ROR1), partial | CSB-YP020067HU

Recombinant Human Inactive tyrosine-protein kinase transmembrane receptor ROR1 (ROR1), partial | CSB-YP020067HU | Cusabio

Alternative Name(s): Neurotrophic tyrosine kinase, receptor-related 1

Gene Names: ROR1

Research Areas: Neuroscience

Organism: Homo sapiens (Human)

AA Sequence: QETELSVSAELVPTSSWNISSELNKDSYLTLDEPMNNITTSLGQTAELHCKVSGNPPPTIRWFKNDAPVVQEPRRLSFRSTIYGSRLRIRNLDTTDTGYFQCVATNGKEVVSSTGVLFVKFGPPPTASPGYSDEYEEDGFCQPYRGIACARFIGNRTVYMESLHMQGEIENQITAAFTMIGTSSHLSDKCSQFAIPSLCHYAFPYCDETSSVPKPRDLCRDECEILENVLCQTEYIFARSNPMILMRLKLPNCEDLPQPESPEAANCIRIGIPMADPINKNHKCYNSTGVDYRGTVSVTKSGRQCQPWNSQYPHTHTFTALRFPELNGGHSYCRNPGNQKEAPWCFTLDENFKSDLCDIPAC

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

Expression Region: 30-391aa

Sequence Info: Partial

MW: 42.6 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Tyrosine-protein kinase receptor whose role is not yet clear.

Reference: Human neural tissues express a truncated Ror1 receptor tyrosine kinase, lacking both Extracellular domain and transmembrane domains.Reddy U.R., Phatak S., Pleasure D.Oncogene 13:1555-1559(1996)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Has very low kinase activity in vitro and is unlikely to function as a tyrosine kinase in vivo

Involvement in disease: Deafness, autosomal recessive, 108 (DFNB108)

Subcellular Location: Membrane, Single-pass type I membrane protein, Cell projection, axon

Protein Families: Protein kinase superfamily, Tyr protein kinase family, ROR subfamily

Tissue Specificity: Expressed strongly in human heart, lung and kidney, but weakly in the CNS. Isoform Short is strongly expressed in fetal and adult CNS and in a variety of human cancers, including those originating from CNS or PNS neuroectoderm.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q01973

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM