Recombinant Human Inactive tyrosine-protein kinase transmembrane receptor ROR1 (ROR1), partial (Active) | CSB-MP020067HU1d7

Recombinant Human Inactive tyrosine-protein kinase transmembrane receptor ROR1 (ROR1) ,partial (Active) | CSB-MP020067HU1d7 | Cusabio

Protein Description: Partial

Alternative Name (s) : (Neurotrophic tyrosine kinase, receptor-related 1)

Gene Names: ROR1

Research Areas: Neuroscience

Species: Homo sapiens (Human)

Source: Mammalian cell

Tag Info: C-terminal 10xHis-tagged

Expression Region: 30-403aa

Sequence Info: QETELSVSAELVPTSSWNISSELNKDSYLTLDEPMNNITTSLGQTAELHCKVSGNPPPTIRWFKNDAPVVQEPRRLSFRSTIYGSRLRIRNLDTTDTGYFQCVATNGKEVVSSTGVLFVKFGPPPTASPGYSDEYEEDGFCQPYRGIACARFIGNRTVYMESLHMQGEIENQITAAFTMIGTSSHLSDKCSQFAIPSLCHYAFPYCDETSSVPKPRDLCRDECEILENVLCQTEYIFARSNPMILMRLKLPNCEDLPQPESPEAANCIRIGIPMADPINKNHKCYNSTGVDYRGTVSVTKSGRQCQPWNSQYPHTHTFTALRFPELNGGHSYCRNPGNQKEAPWCFTLDENFKSDLCDIPACDSKDSKEKNKME

Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized ROR1 at 2 μg/mL can bind anti-ROR1 antibody（CSB-RA020067A1HU）, the EC50 is 0.2450-0.3416 ng/mL.

MW: 44.8 kDa

Purity: Greater than 95% as determined by SDS-PAGE.

Endotoxin: Less than 1.0 EU/ug as determined by LAL method.

Relevance: Has very low kinase activity in vitro and is unlikely to function as a tyrosine kinase in vivo (PubMed:25029443) . Receptor for ligand WNT5A which activate downstream NFkB signaling pathway and may result in the inhibition of WNT3A-mediated signaling (PubMed:25029443, PubMed:27162350) . In inner ear, crucial for spiral ganglion neurons to innervate auditory hair cells (PubMed:27162350) .

PubMed ID:

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Lyophilized powder

Buffer: Lyophilized from a 0.2 μm filtered 20 mM Tris-HCl, 0.5 M NaCl, 6% Trehalose, pH 8.0

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q01973

Uniprot Entry Name:

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A