Cusabio Human Recombinants
Recombinant Human Immunoglobulin lambda-like polypeptide 5 (IGLL5) | CSB-YP494948HU
- SKU:
- CSB-YP494948HU
- Availability:
- 25 - 35 Working Days
Description
Recombinant Human Immunoglobulin lambda-like polypeptide 5 (IGLL5) | CSB-YP494948HU | Cusabio
Alternative Name(s): G lambda-1 Germline immunoglobulin lambda 1
Gene Names: IGLL5
Research Areas: Immunology
Organism: Homo sapiens (Human)
AA Sequence: HGLLRPMVAPQSGDPDPGASVGSSRSSLRSLWGRLLLQPSPQRADPRCWPRGFWSEPQSLCYVFGTGTKVTVLGQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS
Source: Yeast
Tag Info: N-terminal 6xHis-tagged
Expression Region: 36-214aa
Sequence Info: Full Length of Mature Protein
MW: 21.3 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance:
Reference: "Proteomic analyses reveal distinct chromatin-associated and soluble transcription factor complexes."Li X., Wang W., Wang J., Malovannaya A., Xi Y., Li W., Guerra R., Hawke D.H., Qin J., Chen J.Mol. Syst. Biol. 11:775-775(2015)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function:
Involvement in disease:
Subcellular Location: Secreted
Protein Families:
Tissue Specificity: Contrary to IGLL1, not expressed in pre-B-cells.
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: B9A064
HGNC Database Link: HGNC
UniGene Database Link: UniGene
KEGG Database Link: KEGG
STRING Database Link: STRING
OMIM Database Link: N/A