Recombinant Human Immunoglobulin lambda-like polypeptide 5 (IGLL5) | CSB-YP494948HU

(No reviews yet) Write a Review
SKU:
CSB-YP494948HU
Availability:
25 - 35 Working Days
  • Recombinant Human Immunoglobulin lambda-like polypeptide 5 (IGLL5)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
£209.60 - £754.40

Description

Recombinant Human Immunoglobulin lambda-like polypeptide 5 (IGLL5) | CSB-YP494948HU | Cusabio

Alternative Name(s): G lambda-1 Germline immunoglobulin lambda 1

Gene Names: IGLL5

Research Areas: Immunology

Organism: Homo sapiens (Human)

AA Sequence: HGLLRPMVAPQSGDPDPGASVGSSRSSLRSLWGRLLLQPSPQRADPRCWPRGFWSEPQSLCYVFGTGTKVTVLGQPKANPTVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADGSPVKAGVETTKPSKQSNNKYAASSYLSLTPEQWKSHRSYSCQVTHEGSTVEKTVAPTECS

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

Expression Region: 36-214aa

Sequence Info: Full Length of Mature Protein

MW: 21.3 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance:

Reference: "Proteomic analyses reveal distinct chromatin-associated and soluble transcription factor complexes."Li X., Wang W., Wang J., Malovannaya A., Xi Y., Li W., Guerra R., Hawke D.H., Qin J., Chen J.Mol. Syst. Biol. 11:775-775(2015)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location: Secreted

Protein Families:

Tissue Specificity: Contrary to IGLL1, not expressed in pre-B-cells.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: B9A064

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose