Recombinant Human Immunoglobulin iota chain (VPREB1) | CSB-EP025887HU

Recombinant Human Immunoglobulin iota chain (VPREB1) | CSB-EP025887HU | Cusabio

Alternative Name(s): CD179 antigen-like family member A Protein VPreB1 V(pre)B protein Short name:VpreB protein CD_antigen: CD179a

Gene Names: VPREB1

Research Areas: Others

Organism: Homo sapiens (Human)

AA Sequence: QPVLHQPPAMSSALGTTIRLTCTLRNDHDIGVYSVYWYQQRPGHPPRFLLRYFSQSDKSQGPQVPPRFSGSKDVARNRGYLSISELQPEDEAMYYCAMGARSSEKEEREREWEEEMEPTAARTRVP

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 20-145aa

Sequence Info: Full Length of Mature Protein

MW: 30.5 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Associates with the Ig-mu chain to form a molecular complex that is expressed on the surface of pre-B-cells. This complex presumably regulates Ig gene rearrangements in the early steps of B-cell differentiation.

Reference: "The human pre-B cell receptor: structural constraints for a tentative model of the pseudo-light (psi L) chain."Guelpa-Fonlupt V., Bossy D., Alzari P., Fumoux F., Fougereau M., Schiff C.Mol. Immunol. 31:1099-1108(1994)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Associates with the Ig-mu chain to form a molecular complex that is expressed on the surface of pre-B-cells. This complex presumably regulates Ig gene rearrangements in the early steps of B-cell differentiation.

Involvement in disease:

Subcellular Location:

Protein Families: Immunoglobulin superfamily

Tissue Specificity: Only expressed by pre-B-cells.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P12018

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM