Recombinant Human immunodeficiency virus type 1 group M subtype B Envelope glycoprotein gp160 (env), partial | CSB-EP361302HKP

Recombinant Human immunodeficiency virus type 1 group M subtype B Envelope glycoprotein gp160 (env), partial | CSB-EP361302HKP | Cusabio

Alternative Name(s): Env polyprotein

Gene Names: env

Research Areas: Others

Organism: Human immunodeficiency virus type 1 group M subtype B (isolate HXB2) (HIV-1)

AA Sequence: KLWVTVYYGVPVWKEATTTLFCASDAKAYDTEVHNVWATHACVPTDPNPQEVVLVNVTENFNMWKNDMVEQMHEDIISLWDQSLKPCVKLTPLCVSLKCTDLKNDTNTNSSSGRMIMEKGEIKNCSFNISTSIRGKVQKEYAFFYKLDIIPIDNDTTSYKLTSCNTSVITQACPKVSFEPIPIHYCAPAGFAILKCNNKTFNGTGPCTNVSTVQCTHGIRPVVSTQLLLNGSLAEEEVVIRSVNFTDNAKTIIVQLNTSVEINCTRPNNNTRKRIRIQRGPGRAFVTIGKIGNMRQAHCNISRAKWNNTLKQIASKLREQFGNNKTIIFKQSSGGDPEIVTHSFNCGGEFFYCNSTQLFNSTWFNSTWSTEGSNNTEGSDTITLPCRIKQIINMWQKVGKAMYAPPISGQIRCSSNITGLLLTRDGGNSNNESEIFRPGGGDMRDNWRSELYKYKVVKIEPLGVAPTKAKRRVVQREKR

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 33-511aa

Sequence Info: Partial

MW: 69.7 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Envelope glycoprotein gp160: Oligomerizes in the host endoplasmic reticulum into predominantly trimers. In a second time, gp160 transits in the host Golgi, where glycosylation is completed. The precursor is then proteolytically cleaved in the trans-Golgi and thereby activated by cellular furin or furin-like proteases to produce gp120 and gp41.

Reference: HIV enters cells via endocytosis and dynamin-dependent fusion with endosomes.Miyauchi K., Kim Y., Latinovic O., Morozov V., Melikyan G.B.Cell 137:433-444(2009)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Envelope glycoprotein gp160

Involvement in disease:

Subcellular Location: Surface protein gp120: Virion membrane, Peripheral membrane protein, Host cell membrane, Peripheral membrane protein, Host endosome membrane, Single-pass type I membrane protein, Note=The surface protein is not anchored to the viral envelope, but associates with the extravirion surface through its binding to TM, It is probably concentrated at the site of budding and incorporated into the virions possibly by contacts between the cytoplasmic tail of Env and the N-terminus of Gag, SUBCELLULAR LOCATION: Transmembrane protein gp41: Virion membrane, Single-pass type I membrane protein, Host cell membrane, Single-pass type I membrane protein, Host endosome membrane, Single-pass type I membrane protein

Protein Families: HIV-1 env protein family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P04578

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: KEGG

STRING Database Link: N/A

OMIM Database Link: N/A