Recombinant Human Immortalization up-regulated protein (IMUP) | CSB-EP003450HU

(No reviews yet) Write a Review
SKU:
CSB-EP003450HU
Availability:
13 - 23 Working Days
  • Recombinant Human Immortalization up-regulated protein (IMUP)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
$294.00 - $1,532.40

Description

Recombinant Human Immortalization up-regulated protein (IMUP) | CSB-EP003450HU | Cusabio

Alternative Name(s): Hepatocyte growth factor activator inhibitor type 2-related small protein ;H2RSP ;HAI-2-related small protein

Gene Names: IMUP

Research Areas: Epigenetics and Nuclear Signaling

Organism: Homo sapiens (Human)

AA Sequence: MEFDLGAALEPTSQKPGVGAGHGGDPKLSPHKVQGRSEAGAGPGPKASNFRGLGKGRRLTAAPPSSKDTTALPTPAAAPAIRTRM

Source: E.coli

Tag Info: N-terminal GST-tagged

Expression Region: 1-85aa

Sequence Info: Full Length of Isoform 2

MW: 35.5 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance:

Reference: Identification of cDNAs encoding two novel nuclear proteins, IMUP-1 and IMUP-2, upregulated in SV40-immortalized human fibroblasts.Kim J.K., Ryll R., Ishizuka Y., Kato S.Gene 257:327-334(2000)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location: Nucleus

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q9GZP8

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose