Recombinant Human IGF-like family receptor 1 (IGFLR1), partial (Active) | CSB-MP862025HUd9

(No reviews yet) Write a Review
SKU:
CSB-MP862025HUd9
Availability:
3 to 7 Working Days
  • Recombinant Human IGF-like family receptor 1 (IGFLR1) ,partial (Active)
  • Recombinant Human IGF-like family receptor 1 (IGFLR1) ,partial (Active) Activity
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
$328.80 - $484.80

Description

Recombinant Human IGF-like family receptor 1 (IGFLR1) ,partial (Active) | CSB-MP862025HUd9 | Cusabio

Protein Description: Partial

Alternative Name (s) : (Transmembrane protein 149) (U2 small nuclear RNA auxiliary factor 1-like 4)

Gene Names: IGFLR1

Research Areas: Cell Biology

Species: Homo sapiens (Human)

Source: Mammalian cell

Tag Info: C-terminal hFc-tagged

Expression Region: 23-163aa

Sequence Info: SQYCGRLEYWNPDNKCCSSCLQRFGPPPCPDYEFRENCGLNDHGDFVTPPFRKCSSGQCNPDGAELCSPCGGGAVTPTPAAGGGRTPWRCRERPVPAKGHCPLTPGNPGAPSSQERSSPASSIAWRTPEPVPQQAWPNFLP

Biological Activity: Measured by its binding ability in a functional ELISA. Immobilized Human IGFLR1 at 2 μg/mL can bind Human IGFL1 (CSB-MP764932HUh8) , the EC50 is 4.640-5.722 ng/mL.

MW: 44.1 kDa

Purity: Greater than 95% as determined by SDS-PAGE.

Endotoxin: Less than 1.0 EU/ug as determined by LAL method.

Relevance: Probable cell membrane receptor for the IGF-like family proteins. Binds IGFL1 and IGFL3 with a higher affinity. May also bind IGFL2.

PubMed ID:

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4℃ for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Lyophilized powder

Buffer: Lyophilized from a 0.2 μm filtered PBS, 6% Trehalose, pH 7.4

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q9H665

Uniprot Entry Name:

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose