Recombinant Human HLA class II histocompatibility antigen gamma chain (CD74), partial | CSB-EP004956HU1

(No reviews yet) Write a Review
SKU:
CSB-EP004956HU1
Availability:
13 - 23 Working Days
£196.00 - £1,021.60

Description

Recombinant Human HLA class II histocompatibility antigen gamma chain (CD74), partial | CSB-EP004956HU1 | Cusabio

Alternative Name(s): HLA class II histocompatibility antigen gamma chain(HLA-DR antigens-associated invariant chain)(Ia antigen-associated invariant chain)(Ii)(CD antigen CD74) [Cleaved into: Class-II-associated invariant chain peptide(CLIP)]

Gene Names: CD74

Research Areas: Immunology

Organism: Homo sapiens (Human)

AA Sequence: QQQGRLDKLTVTSQNLQLENLRMKLPKPPKPVSKMRMATPLLMQALPMGALPQGPMQNATKYGNMTEDHVMHLLQNADPLKVYPPLKGSFPENLRHLKNTMETIDWKVFESWMHHWLLFEMSRHSLEQKPTDAPPKVLTKCQEEVSHIPAVHPGSFRPKC

Source: E.coli

Tag Info: C-terminal 6xHis-Myc-tagged

Expression Region: 73-232aa

Sequence Info: Partial

MW: 21.0 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Plays a critical role in MHC class II antigen processing by stabilizing peptide-free class II alpha/beta heterodimers in a complex soon after their synthesis and directing transport of the complex from the endoplasmic reticulum to the endosomal/lysosomal system where the antigen processing and binding of antigenic peptides to MHC class II takes place. Serves as cell surface receptor for the cytokine MIF.; [Class-II-associated invariant chain peptide]: Binds to the peptide-binding site of MHC class II alpha/beta heterodimers forming an alpha-beta-CLIP complex, thereby preventing the loading of antigenic peptides to the MHC class II complex until its release by HLA-DM in the endosome.; [Isoform p41]: Stabilizes the conformation of mature CTSL by binding to its active site and serving as a chaperone to help maintain a pool of mature enzyme in endocytic compartments and extracellular space of antigen-presenting cells (APCs). Has antiviral activity by stymieing the endosomal entry of Ebola virus and coronaviruses, including SARS-CoV-2 (PubMed:32855215). Disrupts cathepsin-mediated Ebola virus glycoprotein processing, which prevents viral fusion and entry. This antiviral activity is specific to p41 isoform (PubMed:32855215).

Reference: "MHC class II transactivator CIITA induces cell resistance to Ebola virus and SARS-like coronaviruses." Bruchez A., Sha K., Johnson J., Chen L., Stefani C., McConnell H., Gaucherand L., Prins R., Matreyek K.A., Hume A.J., Muehlberger E., Schmidt E.V., Olinger G.G., Stuart L.M., Lacy-Hulbert A. Science 370:241-247(2020)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P04233

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose