Recombinant Human HLA class I histocompatibility antigen, alpha chain G (HLA-G) | CSB-YP010509HU

Recombinant Human HLA class I histocompatibility antigen, alpha chain G (HLA-G) | CSB-YP010509HU | Cusabio

Alternative Name(s): HLA G antigen (MHC class I antigen G) (HLA-6.0) (HLAG)

Gene Names: HLA-G

Research Areas: Immunology

Organism: Homo sapiens (Human)

AA Sequence: GSHSMRYFSAAVSRPGRGEPRFIAMGYVDDTQFVRFDSDSACPRMEPRAPWVEQEGPEYWEEETRNTKAHAQTDRMNLQTLRGYYNQSEASSHTLQWMIGCDLGSDGRLLRGYEQYAYDGKDYLALNEDLRSWTAADTAAQISKRKCEAANVAEQRRAYLEGTCVEWLHRYLENGKEMLQRADPPKTHVTHHPVFDYEATLRCWALGFYPAEIILTWQRDGEDQTQDVELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLMLRWKQSSLPTIPIMGIVAGLVVLAAVVTGAAVAAVLWRKKSSD

Source: Yeast

Tag Info: N-terminal 6xHis-sumostar-tagged

Expression Region: 25-338aa

Sequence Info: Full Length of Mature Protein

MW: 48.7 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Involved in the presentation of foreign antigens to the immune system. Plays a role in maternal tolerance of the fetus by mediating protection from the deleterious effects of natural killer cells, cytotoxic T-lymphocytes, macrophages and mononuclear cells.

Reference: "A 356-Kb sequence of the subtelomeric part of the MHC class I region." Hampe A., Coriton O., Andrieux N., Carn G., Lepourcelet M., Mottier S., Dreano S., Gatius M.T., Hitte C., Soriano N., Galibert F. DNA Seq. 10:263-299(1999)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P17693

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A