Recombinant Human High mobility group nucleosome-binding domain-containing protein 4 (HMGN4) | CSB-EP010576HU

Recombinant Human High mobility group nucleosome-binding domain-containing protein 4 (HMGN4) | CSB-EP010576HU | Cusabio

Alternative Name(s): HMGN4; HMG17L3; NHC; High mobility group nucleosome-binding domain-containing protein 4; Non-histone chromosomal protein HMG-17-like 3; Non-histone chromosomal protein

Gene Names: HMGN4

Research Areas: Epigenetics and Nuclear Signaling

Organism: Homo sapiens (Human)

AA Sequence: MPKRKAKGDAKGDKAKVKDEPQRRSARLSAKPAPPKPEPRPKKASAKKGEKLPKGRKGKADAGKDGNNPAKNRDASTLQSQKAEGTGDAK

Source: E.coli

Tag Info: N-terminal GST-tagged

Expression Region: 1-90aa

Sequence Info: Full Length

MW: 36.5 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Non-histone chromosomal protein HMG-17-like 3

Reference: "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location: Nucleus

Protein Families: HMGN family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: O00479

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A