Recombinant Human High affinity immunoglobulin epsilon receptor subunit gamma (FCER1G) | CSB-EP008533HU

(No reviews yet) Write a Review
SKU:
CSB-EP008533HU
Availability:
13 - 23 Working Days
  • Recombinant Human High affinity immunoglobulin epsilon receptor subunit gamma (FCER1G)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
$294.00 - $1,532.40

Description

Recombinant Human High affinity immunoglobulin epsilon receptor subunit gamma (FCER1G) | CSB-EP008533HU | Cusabio

Alternative Name(s): Fc receptor gamma-chain ;FcRgammaFc-epsilon RI-gammaIgE Fc receptor subunit gamma ;FceRI gamma

Gene Names: FCER1G

Research Areas: Immunology

Organism: Homo sapiens (Human)

AA Sequence: LGEPQLCYILDAILFLYGIVLTLLYCRLKIQVRKAAITSYEKSDGVYTGLSTRNQETYETLKHEKPPQ

Source: E.coli

Tag Info: N-terminal GST-tagged

Expression Region: 19-86aa

Sequence Info: Full Length of Mature Protein

MW: 34.8 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Associates with a variety of FcR alpha chains to form a functional signaling complex. Regulates several aspects of the immune response. The gamma subunit has a critical role in allowing the IgE Fc receptor to reach the cell surface. Also involved in collagen-mediated platelet activation and in neutrophil activation mediated by integrin.

Reference: An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D., Wang L., Ye M., Zou H.J. Proteomics 96:253-262(2014)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Associates with a variety of FcR alpha chains to form a functional signaling complex. Regulates several aspects of the immune response. The gamma subunit has a critical role in allowing the IgE Fc receptor to reach the cell surface. Also involved in collagen-mediated platelet activation and in neutrophil activation mediated by integrin.

Involvement in disease:

Subcellular Location: Cell membrane, Single-pass type I membrane protein

Protein Families: CD3Z/FCER1G family

Tissue Specificity:

Paythway: FcepsilonRIsignalingpathway

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P30273

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: OMIM

View AllClose

0 Reviews

View AllClose