Recombinant Human herpesvirus 6A DNA polymerase processivity factor (U27) | CSB-YP346759HJZ

(No reviews yet) Write a Review
SKU:
CSB-YP346759HJZ
Availability:
3 - 7 Working Days
  • Recombinant Human herpesvirus 6A DNA polymerase processivity factor (U27)
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
£271.20 - £1,076.00

Description

Recombinant Human herpesvirus 6A DNA polymerase processivity factor (U27) | CSB-YP346759HJZ | Cusabio

Alternative Name(s): Phosphoprotein P41 ;PP41;Polymerase accessory protein ;PAP

Gene Names: U27

Research Areas: Others

Organism: Human herpesvirus 6A (strain Uganda-1102) (HHV-6 variant A) (Human B lymphotropic virus)

AA Sequence: MCWSFHLFFKAHKARVGARTSFLTEMERGSRDHHRDHRDHREHRETREPPTLAFHMKSWKTINKSLKAFAKLLKENTTVTFTPQPSIIIQSAKNHLVQKLTIQAECLFLSDTDRFLTKTINNHIPLFESFMNIISNPEVTKMYIQHDSDLYTRVLVTASDTCTQASVPCVHGQEVVRDTGRSPLRIDLDHSTVSDVLKWLSPVTKTKRSGKSDALMAHIIVQVNPPTIKFVTEMNELEFSNSNKVIFYDVKNMRFNLSAKNLQQALSMCAVIKTSCSLRTVAAKDCKLILTSKSTLLTVEAFLTQEQLKEESRFERMGKQDDGKGDRSHKNDDGSALASKQEMQYKITNYMVPAKNGTAGSSLFNEKEDSESDDSMHFDYSSNPNPKRQRCVV

Source: Yeast

Tag Info: N-terminal 6xHis-tagged

Expression Region: 1-393aa

Sequence Info: Full Length

MW: 46.8 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Accessory subunit of the DNA polymerase that acts to increase the processivity of polymerization.

Reference: Identification, characterization, and sequence analysis of a cDNA encoding a phosphoprotein of human herpesvirus 6.Chang C.K., Balachandran N.J. Virol. 65:2884-2894(1991)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Accessory subunit of the DNA polymerase that acts to increase the processivity of polymerization.

Involvement in disease:

Subcellular Location:

Protein Families: Herpesviridae polymerase accessory protein family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P52439

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose