Cusabio Virus & Bacteria Recombinants
Recombinant Human herpesvirus 6A DNA polymerase processivity factor (U27) | CSB-YP346759HJZ
- SKU:
- CSB-YP346759HJZ
- Availability:
- 3 - 7 Working Days
Description
Recombinant Human herpesvirus 6A DNA polymerase processivity factor (U27) | CSB-YP346759HJZ | Cusabio
Alternative Name(s): Phosphoprotein P41 ;PP41;Polymerase accessory protein ;PAP
Gene Names: U27
Research Areas: Others
Organism: Human herpesvirus 6A (strain Uganda-1102) (HHV-6 variant A) (Human B lymphotropic virus)
AA Sequence: MCWSFHLFFKAHKARVGARTSFLTEMERGSRDHHRDHRDHREHRETREPPTLAFHMKSWKTINKSLKAFAKLLKENTTVTFTPQPSIIIQSAKNHLVQKLTIQAECLFLSDTDRFLTKTINNHIPLFESFMNIISNPEVTKMYIQHDSDLYTRVLVTASDTCTQASVPCVHGQEVVRDTGRSPLRIDLDHSTVSDVLKWLSPVTKTKRSGKSDALMAHIIVQVNPPTIKFVTEMNELEFSNSNKVIFYDVKNMRFNLSAKNLQQALSMCAVIKTSCSLRTVAAKDCKLILTSKSTLLTVEAFLTQEQLKEESRFERMGKQDDGKGDRSHKNDDGSALASKQEMQYKITNYMVPAKNGTAGSSLFNEKEDSESDDSMHFDYSSNPNPKRQRCVV
Source: Yeast
Tag Info: N-terminal 6xHis-tagged
Expression Region: 1-393aa
Sequence Info: Full Length
MW: 46.8 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: Accessory subunit of the DNA polymerase that acts to increase the processivity of polymerization.
Reference: Identification, characterization, and sequence analysis of a cDNA encoding a phosphoprotein of human herpesvirus 6.Chang C.K., Balachandran N.J. Virol. 65:2884-2894(1991)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: Accessory subunit of the DNA polymerase that acts to increase the processivity of polymerization.
Involvement in disease:
Subcellular Location:
Protein Families: Herpesviridae polymerase accessory protein family
Tissue Specificity:
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: P52439
HGNC Database Link: N/A
UniGene Database Link: N/A
KEGG Database Link: N/A
STRING Database Link: N/A
OMIM Database Link: N/A