Recombinant Human herpesvirus 1 Envelope glycoprotein G (gG), partial | CSB-EP361844HWY1

(No reviews yet) Write a Review
SKU:
CSB-EP361844HWY1
Availability:
13 - 23 Working Days
  • Recombinant Human herpesvirus 1 Envelope glycoprotein G (gG), partial
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€245.00 - €372.00

Description

Recombinant Human herpesvirus 1 Envelope glycoprotein G (gG), partial | CSB-EP361844HWY1 | Cusabio

Alternative Name(s): gG-1

Gene Names: gG US4

Research Areas: Others

Organism: Human herpesvirus 1 (strain 17) (HHV-1) (Human herpes simplex virus 1)

AA Sequence: VPTNVSSTTQPQLQTTGRPSHEAPNMTQTGTTDSPTAISLTTPDHTPPMPSIGLEEEEEEEGAGDGEHLEGGDGTRDTLPQSPGPAFPLAEDVEKDKPNRPVVPSPDPNNSPARPETSRPKTPPTIIGPLATRPTTRLTSKGRPLVPTPQHTPLFSFLTASPALD

Source: E.coli

Tag Info: N-terminal 6xHis-SUMO-tagged

Expression Region: 25-189aa

Sequence Info: Partial

MW: 33.4 kDa

Purity: Greater than 90% as determined by SDS-PAGE.

Relevance: Chokine-binding protein that inhibits neutrophils' chotaxis.

Reference: Herpes simplex virus type 1 bacterial artificial chromosome.Cunningham C., Davison A.J. Comprehensive characterization of Extracellular domain herpes simplex virus type 1 virions.Loret S., Guay G., Lippe R.J. Virol. 82:8605-8618(2008)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Chemokine-binding protein that inhibits neutrophils' chemotaxis.

Involvement in disease:

Subcellular Location: Virion membrane, Single-pass type I membrane protein

Protein Families: Alphaherpesvirinae glycoprotein G family

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P06484

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: KEGG

STRING Database Link: N/A

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose