Recombinant Human herpesvirus 1 Envelope glycoprotein G (gG) | CSB-CF361844HWY

Recombinant Human herpesvirus 1 Envelope glycoprotein G (gG) | CSB-CF361844HWY | Cusabio

Alternative Name(s): gG-1

Gene Names: gG

Research Areas: Microbiology

Organism: Human herpesvirus 1 (strain 17) (HHV-1) (Human herpes simplex virus 1)

AA Sequence: VPTNVSSTTQPQLQTTGRPSHEAPNMTQTGTTDSPTAISLTTPDHTPPMPSIGLEEEEEEEGAGDGEHLEGGDGTRDTLPQSPGPAFPLAEDVEKDKPNRPVVPSPDPNNSPARPETSRPKTPPTIIGPLATRPTTRLTSKGRPLVPTPQHTPLFSFLTASPALDTLFVVSTVIHTLSFLCIGAMATHLCGGWSRRGRRTHPSVRYVCLPSERG

Source: in vitro E.coli expression system

Tag Info: N-terminal 10xHis-tagged

Expression Region: 25-238aa

Sequence Info: Full Length of Mature Protein

MW: 28.8 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Chemokine-binding protein that inhibits neutrophils' chemotaxis.

Reference: "Variability of the glycoprotein G gene in clinical isolates of herpes simplex virus type 1." Rekabdar E., Tunback P., Liljeqvist J.-A., Bergstroem T. Clin. Diagn. Lab. Immunol. 6:826-831(1999)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function:

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity:

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: P06484

HGNC Database Link: N/A

UniGene Database Link: N/A

KEGG Database Link: N/A

STRING Database Link: N/A

OMIM Database Link: N/A