Cusabio Human Recombinants
Recombinant Human Hemoglobin subunit gamma-2 (HBG2) | CSB-EP010156HUa1
- SKU:
- CSB-EP010156HUa1
- Availability:
- 13 - 23 Working Days
Description
Recombinant Human Hemoglobin subunit gamma-2 (HBG2) | CSB-EP010156HUa1 | Cusabio
Alternative Name(s): Gamma-2-globin (Hb F Ggamma) (Hemoglobin gamma-2 chain) (Hemoglobin gamma-G chain)
Gene Names: HBG2
Research Areas: Cardiovascular
Organism: Homo sapiens (Human)
AA Sequence: GHFTEEDKATITSLWGKVNVEDAGGETLGRLLVVYPWTQRFFDSFGNLSSASAIMGNPKVKAHGKKVLTSLGDAIKHLDDLKGTFAQLSELHCDKLHVDPENFKLLGNVLVTVLAIHFGKEFTPEVQASWQKMVTGVASALSSRYH
Source: E.coli
Tag Info: N-terminal 6xHis-tagged and C-terminal Myc-tagged
Expression Region: 2-147aa
Sequence Info: Full Length of Mature Protein
MW: 23.0 kDa
Purity: Greater than 85% as determined by SDS-PAGE.
Relevance: Gamma chains make up the fetal hemoglobin F, in combination with alpha chains.
Reference: "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: Gamma chains make up the fetal hemoglobin F, in combination with alpha chains.
Involvement in disease: Cyanosis transient neonatal (TNCY)
Subcellular Location:
Protein Families: Globin family
Tissue Specificity: Red blood cells.
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: P69892
HGNC Database Link: HGNC
UniGene Database Link: UniGene
KEGG Database Link: KEGG
STRING Database Link: STRING
OMIM Database Link: OMIM