Cusabio Human Recombinants
Recombinant Human HemK methyltransferase family member 2 (N6AMT1) | CSB-EP010286HU
- SKU:
- CSB-EP010286HU
- Availability:
- 13 - 23 Working Days
Description
Recombinant Human HemK methyltransferase family member 2 (N6AMT1) | CSB-EP010286HU | Cusabio
Alternative Name(s): M.HsaHemK2P N(6)-adenine-specific DNA methyltransferase 1
Gene Names: N6AMT1
Research Areas: Epigenetics and Nuclear Signaling
Organism: Homo sapiens (Human)
AA Sequence: MAGENFATPFHGHVGRGAFSDVYEPAEDTFLLLNALEAAAAELAGVEICLEVGSGSGVVSAFLASMIGPQALYMCTDINPEAAACTLETARCNKVHIQPVITDLVGSHGIEAAWAGGKNGREVMDRFFPLVPDLLSPKGLFYLVTIKENNPEEILKIMKTKGLQGTTALSRQAGQETLSVLKFTKS
Source: E.coli
Tag Info: N-terminal GST-tagged
Expression Region: 1-186aa
Sequence Info: Full Length of Isoform 2
MW: 46.8 kDa
Purity: Greater than 90% as determined by SDS-PAGE.
Relevance: Heterodimeric methyltransferase that catalyzes N5-methylation of ETF1 on 'Gln-185', using S-adenosyl L-methionine as methyl donor. ETF1 needs to be complexed to ERF3 in its GTP-bound form to be efficiently methylated. May play a role in the modulation of arsenic-induced toxicity. May be involved in the conversion of monomethylarsonous acid (3+) into the less toxic dimethylarsonic acid.
Reference: "Identification of a novel putative eukaryotic DNA-methyltransferase." Reboul J., Misseri Y., Bonnerot C., Mogensen E., Lutfalla G. Submitted (MAR-1999)
Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.
Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.
Function: Heterodimeric methyltransferase that catalyzes N5-methylation of ETF1 on 'Gln-185', using S-adenosyl L-methionine as methyl donor. ETF1 needs to be complexed to ERF3 in its GTP-bound form to be efficiently methylated. May play a role in the modulation of arsenic-induced toxicity. May be involved in the conversion of monomethylarsonous acid (3+) into the less toxic dimethylarsonic acid.
Involvement in disease:
Subcellular Location:
Protein Families: Eukaryotic/archaeal PrmC-related family
Tissue Specificity: Widely expressed, with highest expression in parathyroid and pituitary glands, followed by adrenal gland and kidney, and lowest expression in leukocytes and mammary gland.
Paythway:
Form: Liquid or Lyophilized powder
Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Uniprot ID: Q9Y5N5
HGNC Database Link: HGNC
UniGene Database Link: UniGene
KEGG Database Link: KEGG
STRING Database Link: STRING
OMIM Database Link: OMIM