Recombinant Human HEAT repeat-containing protein 6 (HEATR6), partial | CSB-EP721403HU

(No reviews yet) Write a Review
SKU:
CSB-EP721403HU
Availability:
3 - 7 Working Days
  • Recombinant Human HEAT repeat-containing protein 6 (HEATR6), partial
  • (Tris-Glycine gel) Discontinuous SDS-PAGE (reduced) with 5% enrichment gel and 15% separation gel.
€352.00 - €878.00

Description

Recombinant Human HEAT repeat-containing protein 6 (HEATR6), partial | CSB-EP721403HU | Cusabio

Alternative Name(s): Amplified in breast cancer protein 1 ABC1

Gene Names: HEATR6

Research Areas: Others

Organism: Homo sapiens (Human)

AA Sequence: KSEDTIDFLEFKYCVSLRTQICQALIHLLSLASASDLPCMKETLELSGNMVQSYILQFLKSGAEGDDTGAPHSPQERDQMVRMALKHMGSIQAPTGDTARRAIMGFLEEILAVCFDSSGSQGAL

Source: E.coli

Tag Info: N-terminal 10xHis-tagged and C-terminal Myc-tagged

Expression Region: 1052-1175aa

Sequence Info: Partial

MW: 18.5 kDa

Purity: Greater than 85% as determined by SDS-PAGE.

Relevance: Amplification-dependent oncogene.

Reference: "Structural analysis of the 17q22-23 amplicon identifies several independent targets of amplification in breast cancer cell lines and tumors." Wu G.-J., Sinclair C., Hinson S., Ingle J.N., Roche P.C., Couch F.J. Cancer Res. 61:4951-4955(2001)

Storage: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20?/-80?. The shelf life of lyophilized form is 12 months at -20?/-80?.

Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4? for up to one week.

Function: Amplification-dependent oncogene.

Involvement in disease:

Subcellular Location:

Protein Families:

Tissue Specificity: Amplified in breast cancer cell lines MCF-7 and BT-474.

Paythway:

Form: Liquid or Lyophilized powder

Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

Reconstitution: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20?/-80?. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Uniprot ID: Q6AI08

HGNC Database Link: HGNC

UniGene Database Link: UniGene

KEGG Database Link: KEGG

STRING Database Link: STRING

OMIM Database Link: N/A

View AllClose

0 Reviews

View AllClose